DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Znrf4 and rnf128a

DIOPT Version :9

Sequence 1:NP_001020049.1 Gene:Znrf4 / 301127 RGDID:1563631 Length:327 Species:Rattus norvegicus
Sequence 2:NP_997780.1 Gene:rnf128a / 322325 ZFINID:ZDB-GENE-030131-1044 Length:389 Species:Danio rerio


Alignment Length:353 Identity:91/353 - (25%)
Similarity:136/353 - (38%) Gaps:77/353 - (21%)


- Green bases have known domain annotations that are detailed below.


  Rat    21 LSLSPTDAQVNLSSGDFLDLPALLGVPVDPKRARGYLLVARPADACLAIEGPGLDNRSLDPLVLV 85
            |::|.|:.:.|.|:. |.:...|.|........:|.:.:|.|...|......|..|.|...:.|:
Zfish    37 LNISYTNPENNRSTW-FQEEMGLYGQDSPKAYVKGNVYLASPTYGCDDDTFYGRPNGSKGWIALI 100

  Rat    86 Q-PLGCSWEHTGRRARRARATAA----SMGSE-------APGQLRV------FEDLEVTVRCDQS 132
            | ..||::......|....|.||    ..|||       .||...|      :..:|:....||.
Zfish   101 QRGNGCTFTEKINIAAMNGAAAAIIFNDFGSENRVIQMSHPGTTIVAIMIGNYRGMELVQLLDQG 165

  Rat   133 ARVLL------PHGEPCPEPECHPV--VAASWALARALALAASTLFVLRQLWPWVRGWGSRGTAV 189
            ..|.:      .||   |....:.|  |:.|:.:..|..:.....:..|:|       .|.....
Zfish   166 VPVAIAIEVGKQHG---PWMSHYSVFFVSISFFIVTAATVGYFIFYSARRL-------NSLRQQN 220

  Rat   190 KTQTCQKA---------QVRTFTR-------LSDLCAICLDDYEEGERLKILPCAHAYHCRCIDP 238
            ::|...||         ||||..:       .:|.||:|:|.|:.|:.|.||.|.|.:|..||:|
Zfish   221 RSQKKLKAEAKKAIGQLQVRTLRQGDQEIGPDADACAVCIDSYKAGDVLSILTCNHFFHKSCIEP 285

  Rat   239 WFSRAARRSCPLCKQSVASTHDGSTDGSIGGDEAP---LPGHRPPIWAIQARLRSRRLELLARTV 300
            |.  ...|:||:||..:........|    .:|.|   :|..||  ::....|.|   |..:.| 
Zfish   286 WL--LEHRTCPMCKCDILKALGVELD----VEEQPQISVPDFRP--FSTSEDLHS---ETASHT- 338

  Rat   301 PCRRCNSTTSLGMA-----ENVAPSEAT 323
                .:.|.|.|.|     |::||.|.|
Zfish   339 ----HSETASSGYASMHGNEHLAPPEGT 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Znrf4NP_001020049.1 Peptidases_S8_S53 31..>93 CDD:299169 16/62 (26%)
zf-RING_2 207..252 CDD:290367 20/44 (45%)
rnf128aNP_997780.1 PA_GRAIL_like 38..172 CDD:239037 32/134 (24%)
zf-RING_2 256..297 CDD:290367 19/42 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.