DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Znrf4 and C18B12.4

DIOPT Version :9

Sequence 1:NP_001020049.1 Gene:Znrf4 / 301127 RGDID:1563631 Length:327 Species:Rattus norvegicus
Sequence 2:NP_510498.1 Gene:C18B12.4 / 181600 WormBaseID:WBGene00007666 Length:456 Species:Caenorhabditis elegans


Alignment Length:261 Identity:65/261 - (24%)
Similarity:101/261 - (38%) Gaps:80/261 - (30%)


- Green bases have known domain annotations that are detailed below.


  Rat    62 PADACLAIEGPGLDNRSLDPLVLV-----QPLGCSWEHTGRRARRARATAASMGSEAPGQLRVFE 121
            |....:::||..|.::...|::::     :.:...:..|.....|.|..        ||...:| 
 Worm   133 PGQEPISMEGTELRDKVNIPVLMISHACKEEIAKKFSDTAGYRLRVRID--------PGYYELF- 188

  Rat   122 DLEVTVRCDQSARVLLPHGEPCPEPECHPVVAASWALARALALAASTLFVLRQLWPWVRGWGSRG 186
                        |.|:|.           :|...:..|         ||::...   |||...|.
 Worm   189 ------------RYLIPF-----------LVVIVFCFA---------LFLITLC---VRGCVERR 218

  Rat   187 TAVK----TQTCQKAQVRTFTRLS---DLCAICLDDYEEGERLKILPCAHAYHCRCIDPWFSRAA 244
            ...|    .:..:|..|:.: ||.   |.|||||:.:..||:|:.|||.|.:||.|||.|.:: .
 Worm   219 KLNKRRLSKRNLKKIPVKKY-RLGDDPDTCAICLESFASGEKLRHLPCRHVFHCNCIDVWLTQ-T 281

  Rat   245 RRSCPLCKQSV-------------ASTHDGSTDGSI--------GGDEAPLP-GHRPPIWAIQAR 287
            |:.|||||:.:             |||..|..|.:.        .|.|.|:| |....:|:.|..
 Worm   282 RKICPLCKRKIGTDSDSECSTNDLASTSQGPNDATALYNNADNQSGFELPVPQGQMVDLWSSQEA 346

  Rat   288 L 288
            |
 Worm   347 L 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Znrf4NP_001020049.1 Peptidases_S8_S53 31..>93 CDD:299169 5/35 (14%)
zf-RING_2 207..252 CDD:290367 23/44 (52%)
C18B12.4NP_510498.1 PA <74..176 CDD:333703 6/42 (14%)
HRD1 <223..>335 CDD:227568 38/113 (34%)
RING-H2_RNF103 246..291 CDD:319387 24/45 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I6285
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.