DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Znrf4 and rnf44

DIOPT Version :9

Sequence 1:	NP_001020049.1	Gene:	Znrf4 / 301127	RGDID:	1563631	Length:	327	Species:	Rattus norvegicus
Sequence 2:	XP_004912927.2	Gene:	rnf44 / 100493970	XenbaseID:	XB-GENE-1017306	Length:	505	Species:	Xenopus tropicalis

Alignment Length:	55	Identity:	21/55 - (38%)
Similarity:	34/55 - (61%)	Gaps:	3/55 - (5%)

- Green bases have known domain annotations that are detailed below.

  Rat   208 LCAICLDDYEEGERLKILPCAHAYHCRCIDPWFSRAARRSCPLCKQSVASTH-DG 261
            ||.:|..|:|..:.|::|||.|.:|.:|:|.|..  :.|:||:|:...:..| ||
Frog   452 LCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLK--SNRTCPICRADASEAHRDG 504

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Znrf4	NP_001020049.1	Peptidases_S8_S53	31..>93	CDD:299169
Znrf4	NP_001020049.1	zf-RING_2	207..252	CDD:290367	17/43 (40%)
rnf44	XP_004912927.2	RING-H2_RNF38_like	450..494	CDD:319386	17/43 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1487241at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.920