DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Znrf4 and rnf43

DIOPT Version :9

Sequence 1:NP_001020049.1 Gene:Znrf4 / 301127 RGDID:1563631 Length:327 Species:Rattus norvegicus
Sequence 2:XP_002935238.2 Gene:rnf43 / 100491274 XenbaseID:XB-GENE-952685 Length:689 Species:Xenopus tropicalis


Alignment Length:375 Identity:90/375 - (24%)
Similarity:130/375 - (34%) Gaps:128/375 - (34%)


- Green bases have known domain annotations that are detailed below.


  Rat    10 APLALVALWLVLSLS----------------------PTDAQVNLSSG---DFLDLPALLGVPVD 49
            |.|.|.:|||:|:::                      .|..|...|.|   ..|.|..|.....:
 Frog     4 ARLQLASLWLLLTVTLQAVASAMGTTEREMDVKALIRVTPLQAEESGGVGQGNLTLEGLFARVAE 68

  Rat    50 PKRARGYLLVARPADACLAIEG----PGL--------DNRSLDPLVLVQPLGCSWEHTGRRARRA 102
            ...|.|.||...|...|...|.    ||.        .:|...|.:.:             |.:|
 Frog    69 ISPAEGRLLQFHPLSLCNTSEDDQTKPGFISIVKLETPDRDTQPCLSL-------------ANKA 120

  Rat   103 RATAASMGSEA--------PGQLRVF------------------EDLEVTVRCDQSARVLLPHGE 141
            | .|...|:.|        .|.|:..                  |.|...|..::.|.|.:...|
 Frog   121 R-LAGERGAHAVLFDITNDRGALQQLQQPAGINQPVVLIWGPDAEKLMDVVNKNKEALVKIEVQE 184

  Rat   142 PCPEPECHPV-----VAAS------WALARAL--------ALAASTLFVLRQLWPWVRGWGSR-- 185
            . |:...|.:     ||.:      :|:||.|        ::...||..:.:|       |:|  
 Frog   185 Q-PKWLHHDIWILLTVAGTVMFFVLYAVARLLCRQPPPQDSIQQQTLLAISRL-------GTRRY 241

  Rat   186 -GTAVKTQTCQKAQVRTFTRLSD--LCAICLDDYEEGERLKILPCAHAYHCRCIDPWFSRAARRS 247
             ...:|.|......|.|.:..|.  :|||||:::.:|:.|:||||.|.||..|:|||..:  ..:
 Frog   242 QQRMLKDQRASGGWVETASTSSSVPVCAICLEEFTDGQELRILPCCHEYHLGCVDPWLRQ--NHT 304

  Rat   248 CPLCKQSVASTHDGSTDGSIGGDEAPLPGHRPP----IWAI---QARLRS 290
            ||||...:..:         |....|| .||.|    :|..   .|||.|
 Frog   305 CPLCMYDILDS---------GTPPRPL-AHRAPSQTQLWGRYPGSARLMS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Znrf4NP_001020049.1 Peptidases_S8_S53 31..>93 CDD:299169 16/76 (21%)
zf-RING_2 207..252 CDD:290367 21/46 (46%)
rnf43XP_002935238.2 ZNRF_3_ecto 80..182 CDD:375639 20/115 (17%)
HRD1 <244..366 CDD:227568 38/113 (34%)
RING-H2_RNF43_like 267..311 CDD:319580 22/45 (49%)
RING-H2 finger (C3H2C3-type) 268..308 CDD:319580 20/41 (49%)
DUF4573 523..643 CDD:373595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.