DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elk4 and pnt

DIOPT Version :10

Sequence 1:NP_571005.2 Gene:elk4 / 30093 ZFINID:ZDB-GENE-030716-1 Length:443 Species:Danio rerio
Sequence 2:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster


Alignment Length:81 Identity:52/81 - (64%)
Similarity:61/81 - (75%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


Zfish     5 VTLWQFLLQLLLDPGNEQLICWTNEDGEFKLLQAEEVARLWGARKNKPSMNYDKLSRALRYYYDK 69
            :.||||||:||||...:..|.||.:..||||...:||||.||.|||||.|||:||||.|||||||
  Fly   610 IQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDK 674

Zfish    70 NIIKKVNGQKFVYRFV 85
            |||.|..|:::|||||
  Fly   675 NIIHKTAGKRYVYRFV 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elk4NP_571005.2 ETS 17..89 CDD:197710 43/69 (62%)
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 52/81 (64%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.