DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Leo1 and zormin

DIOPT Version :9

Sequence 1:NP_001005548.1 Gene:Leo1 / 300837 RGDID:1549772 Length:678 Species:Rattus norvegicus
Sequence 2:NP_001261317.1 Gene:zormin / 2769001 FlyBaseID:FBgn0052311 Length:3664 Species:Drosophila melanogaster


Alignment Length:674 Identity:130/674 - (19%)
Similarity:218/674 - (32%) Gaps:208/674 - (30%)


- Green bases have known domain annotations that are detailed below.


  Rat   146 EKAQSDDEKWDGEDKSDQSDDD--------------------EKLQN-SDDEEREQGSDDEKLQN 189
            ||..||:|  :...||.|.|..                    |||.| ..|.||.|....:::|.
  Fly   757 EKVMSDNE--ETVAKSTQVDTQLYPVFTSQSVDSKQLLISTREKLTNVIQDIERAQDEIQQRIQT 819

  Rat   190 SADEEEKMQNTDDEDRAQLSD--DDRQQLSEEEKGNSDDERPAASDNDEEKQNSDDEDRPQVSDE 252
            :..    :|..|....|::..  ::.:.|..:..|...|.|.......:..:|. .:.|.::.|.
  Fly   820 TLG----IQTKDQPSLAKIEQVINNLRMLKAKLDGIKYDYRTLVESVIQFLENI-VQLRREIDDY 879

  Rat   253 EKMQNSDDERPQVSDEDRRHSDDEEEQDQKSESARGSDSEDEVLRMKRKNAI--PSDSEVDSD-- 313
            ...|    ::...|..||..::.|:.:||..:..|...::.|:| :.|...:  |...|:|:|  
  Fly   880 FARQ----QKEPASGADRSIAEHEKFRDQCMDKFRSLITQSELL-IDRVRVLEPPGAREIDTDRI 939

  Rat   314 ----------------------TEVPKDNNGTMDLFGGADDISSGSD--GEDKPPTPGQPVD--- 351
                                  ..:.|......||    :||....|  .:.......|.||   
  Fly   940 LKLLENLRLHFESNSSARMSTLERLEKIEQFRSDL----EDIDRSLDSVSQQLHEINNQSVDSLA 1000

  Rat   352 ----------------ENGLPQDQQEEEPIPETR--------------IEVEIPKVNTDLGNDLY 386
                            |..:|:.      :..||              :|..|.|........|:
  Fly  1001 AAKTTSLAFEYFERTIECSMPRQ------LKSTRHQRRWGQTAHTIELLEKRIEKFTESTSQQLF 1059

  Rat   387 FVKLPNFLSVEPRPFDPQYYEDE----------------------------FEDEEMLDEEGR-- 421
            ..          .|...:|.:||                            ||..|.:|.|.|  
  Fly  1060 IT----------NPESERYVKDELRKLNEKWQSFKDQVKQKRKSLNQATDFFEVVEKIDAEYREI 1114

  Rat   422 TRLKLKVENTIRWRMRRDEEGNEIKESNARIV--------KWSDGSMSLHLGNEVFDVYKAPLQG 478
            :.....|.|.:.:.....|.||.:.:....:.        |....|...|..|:|..:|     .
  Fly  1115 SYFYTSVSNKVPYLRDSVEAGNLVNDIENYVTSREAALRSKLDSASQCAHDMNKVSSLY-----N 1174

  Rat   479 DHNHLFIRQGTGLQGQAVFKTKLTFRPHSTDSATHRKMTLSLADRCSKTQKIRILPMAGRDPECQ 543
            |..::|         |:..|.|:..      :....::.   .::..|.|:.|    ..|| :.:
  Fly  1175 DVMNIF---------QSFIKLKMDI------NVVQERLK---QEQRQKEQRER----DARD-QAE 1216

  Rat   544 RTEMIKKEEERLRASIRRESQQRRMREKQH------QRGLSASYLEPDRYDEEEEGEESVSLAAI 602
            |.:.||:.|.:.|  :.||.|.|...::|.      ||.|:|..|   ...|:...||...|.||
  Fly  1217 REKAIKEAEAKER--LHREEQSRLENQRQQAAIEQAQRELAAREL---ALREQAVREEEARLQAI 1276

  Rat   603 KNR-------YKGGIREERARIYS-SDSDEGSEE-------DKAQRLLKAKKLNSDEEGESSGKR 652
            :.:       .:...|||..||.| .|.....||       |:..|:.:.::.....|.||..||
  Fly  1277 REQATREQLAREQAAREEELRIQSLRDIARREEEVRLQNIRDEETRIRREEEERIRRENESRSKR 1341

  Rat   653 KAEDDDKANKKHKKYVISDEEEEE 676
            :.|...:..:..:...:.|:.:::
  Fly  1342 EEEARIQREEITRLQTLRDQVDQQ 1365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Leo1NP_001005548.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..373 57/310 (18%)
PHA02664 <33..183 CDD:177447 17/57 (30%)
PHA02664 <134..259 CDD:177447 29/135 (21%)
Leo1 386..544 CDD:281933 31/195 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..596 12/42 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 613..678 16/72 (22%)
zorminNP_001261317.1 SPEC 126..332 CDD:238103
SPEC <504..641 CDD:295325
COG1340 960..1298 CDD:224259 72/390 (18%)
RILP-like <1190..1315 CDD:304877 35/143 (24%)
MAP7 1233..1365 CDD:283355 33/134 (25%)
I-set 1390..1479 CDD:254352
IGc2 1403..1469 CDD:197706
I-set 1491..1580 CDD:254352
IGc2 1504..1570 CDD:197706
I-set 1589..1675 CDD:254352
Ig 1605..1675 CDD:299845
I-set 1702..1786 CDD:254352
Ig 1713..1786 CDD:299845
I-set 1811..1902 CDD:254352
Ig 1828..1892 CDD:143165
I-set 1927..2015 CDD:254352
IGc2 1940..2005 CDD:197706
I-set 2142..2231 CDD:254352
Ig 2158..2231 CDD:299845
I-set 2238..2325 CDD:254352
Ig 2254..2324 CDD:299845
I-set 3566..3655 CDD:254352
Ig 3583..3650 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.