DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mitfa and Usf

DIOPT Version :9

Sequence 1:NP_570998.1 Gene:mitfa / 30080 ZFINID:ZDB-GENE-990910-11 Length:412 Species:Danio rerio
Sequence 2:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster


Alignment Length:468 Identity:89/468 - (19%)
Similarity:139/468 - (29%) Gaps:193/468 - (41%)


- Green bases have known domain annotations that are detailed below.


Zfish    36 LSSALGAKLS-PQASTGPGPSQPAEHGMTPGPG------------------ASAPNSPMAL---- 77
            |:...|:..| ...||.|.....:....|.|||                  :|..|...:|    
  Fly     9 LNMEFGSSTSNTNTSTSPSSVNISNANPTAGPGLMTITNHHTADLSEALVHSSFANGQQSLILTS 73

Zfish    78 ---------------LTLNCEKEMDDVIE-DIISLESSYSDDILGFMDAGLQMTNTI-------- 118
                           ||:..::..||..| ..|..|.....||...:.:.||:.|.:        
  Fly    74 DTGNPLMNSQGAQIFLTICGDENSDDSQEYYTIKQEPGCDLDIHSLLPSNLQLPNNLQLPTGCEI 138

Zfish   119 -------------PVSANL---LDMYSNHALPPAGVSISNSCPSSL-------PAVKRELSVTPS 160
                         |..|.:   ||..|...|.|: |:.|:|..|::       |.:...::.|.|
  Fly   139 YLVKETGSLMGEPPTKAAIKLELDTLSEKPLLPS-VTTSSSTQSAVITAQTVNPPIPGNINTTTS 202

Zfish   161 P--------------------GMMHIM-----DKAG--PCGKFDSYQRPDGFPVEAEVRALAKER 198
            .                    |..|..     :.||  |..|.::|::.|.              
  Fly   203 TTSTTTTTSVLYGSHGNGHGHGHAHAQARSQPESAGQTPSSKLEAYKKRDD-------------- 253

Zfish   199 QKKDNHNLIERRRRFNINDRIKELGTLIPK----------SNDPDMRW----------------- 236
            :::..||.:|||||..||..|.:|..::|.          |..|....                 
  Fly   254 KRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKGNASSS 318

Zfish   237 --------NKGTILKASVDYIRKLQKEQQKAKELENRQKRLEHANRHLLLRIQEL----EMQARA 289
                    :|..||..:.:||:.:|.|....::.......|..:|:.|...:..|    ::|.|.
  Fly   319 SGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQALREELDRLKRQQQLQERF 383

Zfish   290 HGLTVVASSSLYSAELVARAIKQEPGMGDCTSNLYPHLPSPDMSRPTTLDLNNGTISYNDSPTED 354
            |                       ...|..|.|:             ||:      |.|.|.|.|
  Fly   384 H-----------------------TAGGRSTFNV-------------TLN------SLNSSATSD 406

Zfish   355 GEPGVYDSPNKAS 367
            ...|:..:||.|:
  Fly   407 LFEGIDTTPNLAA 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mitfaNP_570998.1 MITF_TFEB_C_3_N <11..90 CDD:292573 17/91 (19%)
HLH 197..257 CDD:238036 21/94 (22%)
DUF3371 285..392 CDD:288684 17/83 (20%)
UsfNP_572167.3 HLH 255..343 CDD:278439 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.