Sequence 1: | NP_570985.1 | Gene: | meis2b / 30066 | ZFINID: | ZDB-GENE-000210-23 | Length: | 393 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286352.1 | Gene: | achi / 36373 | FlyBaseID: | FBgn0033749 | Length: | 555 | Species: | Drosophila melanogaster |
Alignment Length: | 286 | Identity: | 73/286 - (25%) |
---|---|---|---|
Similarity: | 106/286 - (37%) | Gaps: | 103/286 - (36%) |
- Green bases have known domain annotations that are detailed below.
Zfish 142 NPELDNLMIQSIQVLRFHLLELEKVHELCDNFCHRYISCL----KGKMPIDLVIDERDGCKSDFD 202
Zfish 203 DLSGSSTNLADHNPASWRDM--DDAHSTPSVGTPGPSSGGHASQSGDNSSELGDGLDNSLASPGT 265
Zfish 266 GDEDDQDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTNLQVNNWFINAR 330
Zfish 331 RRIVQPMI-----DQSNRAVS-QGTAYSPD------------------GQPMGGFVLD------- 364
Zfish 365 -GQQHMGLR---------PGGPMGGM 380 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
meis2b | NP_570985.1 | Meis_PKNOX_N | 112..195 | CDD:293102 | 14/56 (25%) |
Homeobox_KN | 293..332 | CDD:283551 | 21/38 (55%) | ||
achi | NP_001286352.1 | Homeobox_KN | 111..150 | CDD:283551 | 21/38 (55%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170587149 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0773 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |