DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meis2b and achi

DIOPT Version :9

Sequence 1:NP_570985.1 Gene:meis2b / 30066 ZFINID:ZDB-GENE-000210-23 Length:393 Species:Danio rerio
Sequence 2:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster


Alignment Length:286 Identity:73/286 - (25%)
Similarity:106/286 - (37%) Gaps:103/286 - (36%)


- Green bases have known domain annotations that are detailed below.


Zfish   142 NPELDNLMIQSIQVLRFHLLELEKVHELCDNFCHRYISCL----KGKMPIDLVIDERDGCKSDFD 202
            |..||..:.|:||         :.:||     .|...|.|    :|:...|..:|: |...:|..
  Fly    10 NMVLDRHVRQNIQ---------DMMHE-----AHVQASLLENEGRGRFHSDSSLDQ-DSLHADVI 59

Zfish   203 DLSGSSTNLADHNPASWRDM--DDAHSTPSVGTPGPSSGGHASQSGDNSSELGDGLDNSLASPGT 265
            .....||....:...::.||  |..|              |...:|            ||     
  Fly    60 VEEDQSTEHGANQVQNYHDMMVDSEH--------------HIDING------------SL----- 93

Zfish   266 GDEDDQDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTNLQVNNWFINAR 330
                      :|:||..||.:..|::.||::|..:.|||:.:|..|:|:..||.|||.|||||||
  Fly    94 ----------RKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINAR 148

Zfish   331 RRIVQPMI-----DQSNRAVS-QGTAYSPD------------------GQPMGGFVLD------- 364
            |||:..||     |..:..:| :|...||:                  |.|....|:.       
  Fly   149 RRILPEMIRREGNDPLHFTISRRGKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDG 213

Zfish   365 -GQQHMGLR---------PGGPMGGM 380
             |:.|.|:.         ..||.|.|
  Fly   214 AGEIHEGIANVLTNFEQYVQGPNGQM 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meis2bNP_570985.1 Meis_PKNOX_N 112..195 CDD:293102 14/56 (25%)
Homeobox_KN 293..332 CDD:283551 21/38 (55%)
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 21/38 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587149
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.