DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAX and hbn

DIOPT Version :9

Sequence 1:NP_038463.2 Gene:RAX / 30062 HGNCID:18662 Length:346 Species:Homo sapiens
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:231 Identity:87/231 - (37%)
Similarity:111/231 - (48%) Gaps:50/231 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   126 LSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAK 190
            ||:.|:|:|. ||:||||||:|||:|||||||:.||||::||:||.:::|.|.||||||||||||
  Fly   144 LSDMERPRKV-RRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAK 207

Human   191 WRRQEKL---EVSSMKLQDSPLLSFSRSPPSATLSPLG--AGPGS------------------GG 232
            ||::||.   :.:...|.:..|..|   |....|.|.|  ..|||                  ..
  Fly   208 WRKREKFMNQDKAGYLLPEQGLPEF---PLGIPLPPHGLPGHPGSMQSEFWPPHFALHQHFNPAA 269

Human   233 GPAGGALP----------------LESWLG----PPLPGGGATALQSLPGFGPPAQ-SLPA--SY 274
            ..|.|.||                |..::|    ..:.|.||.|..:....|.|.. ||.|  |.
  Fly   270 AAAAGLLPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAAAAAAAASAGYPQNLSLHAGLSA 334

Human   275 TPPPPPPPFLNSPPLGPGLQPLAPPPPSYPCGPGFG 310
            .....||...:||...|.|.|...||.:.|...|.|
  Fly   335 MSQVSPPCSNSSPRESPKLVPHPTPPHATPPAGGNG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAXNP_038463.2 Octapeptide motif 33..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..145 11/18 (61%)
Homeobox 140..192 CDD:278475 38/51 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..318 40/163 (25%)
OAR 319..335 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 323..336
Nuclear localization signal. /evidence=ECO:0000255 329..333
hbnNP_788420.1 Homeobox 156..209 CDD:278475 38/52 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.