Sequence 1: | NP_038463.2 | Gene: | RAX / 30062 | HGNCID: | 18662 | Length: | 346 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_726006.3 | Gene: | Rx / 37367 | FlyBaseID: | FBgn0020617 | Length: | 904 | Species: | Drosophila melanogaster |
Alignment Length: | 370 | Identity: | 125/370 - (33%) |
---|---|---|---|
Similarity: | 138/370 - (37%) | Gaps: | 188/370 - (50%) |
- Green bases have known domain annotations that are detailed below.
Human 133 KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKL 197
Human 198 EVSSMKLQDSPLLSFSRSPPSATLSPLGAGPGSGGGPAGGALPLESWLGPPLPGGGATALQSLPG 262
Human 263 F------------GPPAQSLPASYT------------------------------PPPPPPPF-- 283
Human 284 ----------------------------LNSP-----PLGPGLQPLAPP---------------- 299
Human 300 ----------------------------------------------------------------- 299
Human 300 ---PPSYPCGPGFGDKFPLDEADPRNSSIAALRLKAKEHIQAIGK 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RAX | NP_038463.2 | Octapeptide motif | 33..40 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 46..145 | 11/11 (100%) | |||
Homeobox | 140..192 | CDD:278475 | 50/51 (98%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..318 | 52/284 (18%) | |||
OAR | 319..335 | CDD:281777 | 10/15 (67%) | ||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 323..336 | 9/12 (75%) | |||
Nuclear localization signal. /evidence=ECO:0000255 | 329..333 | 2/3 (67%) | |||
Rx | NP_726006.3 | Homeobox | 563..615 | CDD:278475 | 50/51 (98%) |
OAR | 876..892 | CDD:281777 | 10/15 (67%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 119 | 1.000 | Domainoid score | I5823 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D454642at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 1 | 1.000 | - | - | otm42185 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_106944 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2565 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.850 |