DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAX and CG11294

DIOPT Version :10

Sequence 1:NP_038463.2 Gene:RAX / 30062 HGNCID:18662 Length:346 Species:Homo sapiens
Sequence 2:NP_572500.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:153 Identity:66/153 - (43%)
Similarity:87/153 - (56%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   117 VGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQ 181
            :.|..|:. |:|....:::.||||||||..||.|||..|:|:|||||:.|||:|.:::|.|.|||
  Fly     6 ISPLPGDL-LTEYMFGRRRQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARVQ 69

Human   182 VWFQNRRAKWRRQEKLEVSSMKLQDSPLLSFSRSPPSATLSPLGAGPGSGGGPAGGALPLESWLG 246
            |||||||||||:|.:|::    |||:..:        ..|| ||..|..|||...|.        
  Fly    70 VWFQNRRAKWRKQARLQL----LQDAWRM--------RCLS-LGTPPVMGGGAVQGG-------- 113

Human   247 PPLPGGGATALQSLPGFGPPAQS 269
               .|.||||       .||:|:
  Fly   114 ---SGNGATA-------RPPSQT 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAXNP_038463.2 Octapeptide motif 33..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..145 11/27 (41%)
Homeodomain 137..193 CDD:459649 39/55 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..318 22/76 (29%)
OAR 319..335 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 323..336
Nuclear localization signal. /evidence=ECO:0000255 329..333
CG11294NP_572500.1 Homeodomain 29..81 CDD:459649 35/51 (69%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.