DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH3KBP1 and Crk

DIOPT Version :10

Sequence 1:NP_001397685.1 Gene:SH3KBP1 / 30011 HGNCID:13867 Length:709 Species:Homo sapiens
Sequence 2:NP_651908.1 Gene:Crk / 43775 FlyBaseID:FBgn0024811 Length:271 Species:Drosophila melanogaster


Alignment Length:170 Identity:51/170 - (30%)
Similarity:86/170 - (50%) Gaps:16/170 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     2 VEAIV-EFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQ-INGRRGLFPDNFVREIKKEMKKDP 64
            ||.:: :||:.....|:|....||::|.:||::..||..: .:|:.|..|..::::....|.:|.
  Fly   108 VEKVIGKFDFVGSDQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQYDDYMDEDA 172

Human    65 LTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDE--LELKVGDIIEV 127
            :....|.      .||:|.:...|:.||: ...:.....:|..|.:|...|:  |:|::||||:|
  Fly   173 IDKNEPS------ISGSSNVFESTLKRTD-LNRKLPAYARVKQSRVPNAYDKTALKLEIGDIIKV 230

Human   128 VGEVEEGWWEGVLNGKTGMFPSNFIK-----ELSGESDEL 162
            ......|.|||.||||.|.||...::     :||..|.|:
  Fly   231 TKTNINGQWEGELNGKNGHFPFTHVEFVDDCDLSKNSTEI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH3KBP1NP_001397685.1 SH3_CIN85_1 3..55 CDD:212985 15/53 (28%)
SH3_CIN85_2 102..154 CDD:212988 22/58 (38%)
SH3_CIN85_3 315..370 CDD:212990
CrkNP_651908.1 SH2_CRK_like 4..108 CDD:198180 51/170 (30%)
SH3_CRK_N 109..163 CDD:212692 15/53 (28%)
SH3_CRK_C 201..257 CDD:212693 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.