DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc22a22 and CG33233

DIOPT Version :9

Sequence 1:NP_001013969.1 Gene:Slc22a22 / 299944 RGDID:1304605 Length:555 Species:Rattus norvegicus
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:442 Identity:111/442 - (25%)
Similarity:178/442 - (40%) Gaps:120/442 - (27%)


- Green bases have known domain annotations that are detailed below.


  Rat   122 YDHSVFTSTIVTEWDLV---CDFQSF--KYYAQATSLAGHFVAAP-FCGIISDRFGRK---PLLM 177
            |.:|| |.::...:.:|   |:|.:.  :....|.||.|..||:. |.|.::||:|||   .|.:
  Fly    30 YMYSV-TESMTAGYLVVLTSCEFDTSPKEKTLLANSLLGGMVASGLFIGFLADRYGRKFVIRLAL 93

  Rat   178 YCSLAYGILGTCCAFVPNFSLYCVLR-----FLSSASASTVGMNCLILVLEETSVQWH-ATVIVL 236
            ..:|::.::.   |.:|:.....|:|     |||:.::..||     .:.|..:::|. .||.:.
  Fly    94 VGALSFSVIS---ALMPDLYSLSVIRIIVGTFLSAVASLQVG-----FLGEFHAIKWRPITVAIC 150

  Rat   237 SGLFSSTGLA----GLGGLA-------------YVLSDWHLIQLTSALPYFIFFILFCWVPESAR 284
            |   .|.|||    .|..:|             |.|..|..:.:...:|.::..:..|.|||:..
  Fly   151 S---QSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPH 212

  Rat   285 WLMITGKTDQALKELQRIASINGKK--DIAQNLTTEDLRSKVKEDVCSTVKHFSIKDIIINPMIR 347
            :||...:.|:||..|:.|..:|.||  |:...|:.|...:..:|....|| .:..|.:...|.:.
  Fly   213 FLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSSTNDQEGFWKTV-WYEYKLLFSKPHVF 276

  Rat   348 KIVLCYSSVLFAELFSIFGLLLDVHMLGKNIFVTQILLGVIDIPSKSLTYF-ILRN--------- 402
            |..:|        ||.|||           ||.|.|.||:         :| ::||         
  Fly   277 KFFIC--------LFLIFG-----------IFFTSIGLGI---------WFPVIRNMDNSGSNRL 313

  Rat   403 ---VRRRPLIAFLLFATGGCITITMFLSEDMYVLRLAIFILGKGCFAAFISINTAYCNELSPVPL 464
               |...|             |.....::|.           .|..:.....|....|.:.||..
  Fly   314 CDLVNNNP-------------TFINHEADDT-----------NGTDSESPKCNDEMTNLIDPVYY 354

  Rat   465 RSTLNGIYISVARLASVLSALTLVTRKYFVLLPMIFCGVLPIVATINIYFLP 516
            ..|..|.:|    |||||  :..:||||.:.|.::...:|.|  ::||...|
  Fly   355 GFTYIGCFI----LASVL--VHWMTRKYVIALHILISMILGI--SLNIMKQP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc22a22NP_001013969.1 2A0119 11..526 CDD:273328 111/442 (25%)
MFS 127..516 CDD:119392 107/435 (25%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 111/442 (25%)
MFS 23..>208 CDD:119392 47/189 (25%)
MFS 354..>482 CDD:304372 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346991
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.