DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GZMH and CG18420

DIOPT Version :9

Sequence 1:NP_219491.1 Gene:GZMH / 2999 HGNCID:4710 Length:246 Species:Homo sapiens
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:281 Identity:74/281 - (26%)
Similarity:119/281 - (42%) Gaps:62/281 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     1 MQPFLLLLAF--------LLTPGAGTE-------EIIGGHEAKPHSRPYMAFV-----QFLQEKS 45
            |...||||..        .|....||.       .|:.|..|..:|.|:|||:     ||:    
  Fly     8 MASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFI---- 68

Human    46 RKRCGGILVRKDFVLTAAHC--QGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSND 108
               |||.|:.:..|||||||  ..::|.|.||.:|.|.:...::. .|.|...|..|:|...:||
  Fly    69 ---CGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEH-QVNRTFQHRFYDPNTHAND 129

Human   109 IMLLQLERKAKWTTAVRPLRL---PSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDC 170
            |.||:|.....:...:||:.:   .|.|..:...::.:..|||.......::.|:.:.::.|...
  Fly   130 IALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSK 194

Human   171 QC-------ERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPL--------VCKDVAQGILSYGN 220
            .|       .:...||::  :.:|:           ||:|||:        ..:.|..|| :..|
  Fly   195 MCAFGSVLSNQFCAGNWN--SNLCI-----------GDTGGPVGAMVRYRNAFRFVQVGI-AITN 245

Human   221 KKGTPPGVYIKVSHFLPWIKR 241
            |:...|.|:..|...:.:|:|
  Fly   246 KRCQRPSVFTDVMSHIEFIRR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GZMHNP_219491.1 Tryp_SPc 21..242 CDD:238113 66/246 (27%)
Mediates the preference for acidic residues at the P3' and P4' sites 46..48 0/1 (0%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 64/243 (26%)
Tryp_SPc 43..267 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.