DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RHOD and rho4

DIOPT Version :9

Sequence 1:NP_055393.1 Gene:RHOD / 29984 HGNCID:670 Length:210 Species:Homo sapiens
Sequence 2:NP_001018257.1 Gene:rho4 / 3361476 PomBaseID:SPAC16A10.04 Length:203 Species:Schizosaccharomyces pombe


Alignment Length:211 Identity:98/211 - (46%)
Similarity:141/211 - (66%) Gaps:11/211 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQV--KGK 63
            |:|.:.:|.::.   .|.|:|:|||||||||.||:||:.|.|||.|.|||||.|:.::..  ..|
pombe     1 MSAFKKSGSKSE---TSKKLVVVGDGGCGKTCLLIVFSSGTFPERYVPTVFENYITDITYGPNSK 62

Human    64 PVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVG 128
            .:.|.:||||||::|||||||.||:::|:||||.:..|.|.:|:..:|||||.|||.:.||::||
pombe    63 VIELALWDTAGQEEYDRLRPLSYPNSNVILLCFSIDCPASLNNVTEKWYPEVQHFCPRTPIVLVG 127

Human   129 CKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSS 193
            .|.|||||::....||..||.||||.:.|.:|.|:.| .|:||||:.:..|:.|||.|..:.:. 
pombe   128 LKADLRKDRNATEVLRTQGLTPVTYQQAQSVALSMNA-PYVECSAKENTGVNEVFQLAVGLTIK- 190

Human   194 RGRNFWRRITQGFCVV 209
              ::|  ..::..||:
pombe   191 --KSF--SFSKKSCVI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RHODNP_055393.1 Rho4_like 16..210 CDD:206704 95/196 (48%)
rho4NP_001018257.1 Rho4_like 12..189 CDD:206704 92/180 (51%)
RHO 17..185 CDD:197554 89/168 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.