DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBQLN2 and CG3223

DIOPT Version :9

Sequence 1:NP_038472.2 Gene:UBQLN2 / 29978 HGNCID:12509 Length:624 Species:Homo sapiens
Sequence 2:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster


Alignment Length:580 Identity:107/580 - (18%)
Similarity:175/580 - (30%) Gaps:209/580 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    54 VQQFKEAISKRFKSQTD--QLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPS 116
            |...|..::|....|.|  :|.:|..|::|:|.||| ...:.....:|..   |...:.....|.
  Fly    27 VAYLKAVVTKEMHLQFDASELEIIHHGRVLEDADTL-NRTLQPNAVIHCF---QKIKRYSPYVPP 87

Human   117 NAAGTNTTSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPEM 181
            .||..||.....                |.||     .|.|.:|.|:...:   :|:.|...||.
  Fly    88 AAAEINTKHIQE----------------LFSL-----TSHLQISVTSRFNI---LQKILAEYPEF 128

Human   182 MIQIMENPFVQ-----SMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARNP 241
            ...:.....::     :||..|::::.|:...|   .:.:..|.|      .|.:|:  |:|||.
  Fly   129 RRNLGAQALIRDSVLFNMLHEPEVVQNLVKDYP---LICEAAPFI------VDTIRK--ELARNS 182

Human   242 AMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSSSGEGTQ 306
            :..|                                     .|||                    
  Fly   183 SATQ-------------------------------------LQEQ-------------------- 190

Human   307 PSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYVASIFSTPGMQS 371
                               ..|.:|||:......|:|:|||..:.:|..||              
  Fly   191 -------------------AASESTTSSEEENSLGAGSSSSGGSSSTAVAA-------------- 222

Human   372 LLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANPQLQEQMRPQLPAFLQQ 436
                           .:|...|..|.::.|   ::.|.:.|:                       
  Fly   223 ---------------AAAANRRDEMANIRQ---ISRQQLANA----------------------- 246

Human   437 MQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPI 501
            :.|....:::||.....|...:|...:...|.||      ..||| |..||..|........|.|
  Fly   247 LANVTPFNSLSNIAQRNADEAVQGDERPRTTSAP------LAGVG-GAAGTGAGSSSGAISSGSI 304

Human   502 GPIV-------PFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQF 559
            ...:       .|..:....|    .|..........||. |..::.||::......:.|.:...
  Fly   305 SSELLRNELARAFQSLSQDQP----APVENMEVESGEGPV-PEQAATAPADDVDDEDDGGDDSDV 364

Human   560 IQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLL 619
            :.:..:             ..||.:||..:.||||:|...|:..|..:.|::..||..|:
  Fly   365 LPRRYR-------------RHRFTEQLRTMAAMGFINHTQNVSYLELSDGNVEHAINLLM 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBQLN2NP_038472.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
UBQ 33..103 CDD:214563 14/50 (28%)
hPLIC_N 33..103 CDD:176403 14/50 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..141 5/34 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..349 9/61 (15%)
STI1 382..426 CDD:128966 6/43 (14%)
12 X 3 AA tandem repeats of P-X-X 491..526 5/41 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 512..556 8/43 (19%)
UBA_PLICs 581..620 CDD:270582 15/39 (38%)
CG3223NP_649758.1 UBA_like_SF 373..410 CDD:304366 14/36 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10677
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.