DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment UBQLN2 and Nedd8

DIOPT Version :9

Sequence 1:	NP_038472.2	Gene:	UBQLN2 / 29978	HGNCID:	12509	Length:	624	Species:	Homo sapiens
Sequence 2:	NP_001286070.1	Gene:	Nedd8 / 35151	FlyBaseID:	FBgn0032725	Length:	84	Species:	Drosophila melanogaster

Alignment Length:	71	Identity:	22/71 - (30%)
Similarity:	34/71 - (47%)	Gaps:	1/71 - (1%)

- Green bases have known domain annotations that are detailed below.

Human    32 IIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGL 96
            :|||...|.|| .|..:.....|.:.||.:.::......|..|||:||.:.|..|...:.:..|.
  Fly     2 LIKVKTLTGKE-IEIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAADYKVQGGS 65

Human    97 TVHLVI 102
            .:|||:
  Fly    66 VLHLVL 71

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
UBQLN2	NP_038472.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..32		22/71 (31%)
		UBQ	33..103	CDD:214563	22/70 (31%)
		hPLIC_N	33..103	CDD:176403	22/70 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	106..141
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	287..349
		STI1	382..426	CDD:128966
		12 X 3 AA tandem repeats of P-X-X	491..526
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	512..556
		UBA_PLICs	581..620	CDD:270582
Nedd8	NP_001286070.1	Ubl_NEDD8	3..76	CDD:340504	22/70 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900