DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GYS1 and Alg1

DIOPT Version :10

Sequence 1:NP_002094.2 Gene:GYS1 / 2997 HGNCID:4706 Length:737 Species:Homo sapiens
Sequence 2:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster


Alignment Length:152 Identity:32/152 - (21%)
Similarity:51/152 - (33%) Gaps:36/152 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   379 TLKGQAVRKQLWDTANTVKE--KFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFP 441
            |.|.:.:.|..|.|.:.:..  ..||..:  |||.:.|.:..::....:..:.|...|....::.
  Fly    73 TPKLRLLFKAFWQTLSLLMALISIGRPSF--LLVQNPPGIPTLIVCYLYCAVTRTKLAIDWHNYT 135

Human   442 -PVCTHNMLDDSSDPILTTIRRI-GLFNSSA---------------------------DRVKVIF 477
             .|....|......|::..:||: ..|.|.|                           ||....|
  Fly   136 YTVLALGMSKGEQSPLIRLVRRLERYFGSKAHTHFCVTRAMQEDLQQNWGIGPVKVLYDRAPAQF 200

Human   478 HPEFLSSTSPL---LPVDYEEF 496
            ||..|:....|   |..||.:|
  Fly   201 HPIDLTHKHELYLKLAKDYPQF 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GYS1NP_002094.2 Glycogen_syn 31..663 CDD:399009 32/152 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 634..737
Alg1NP_650662.1 GT33_ALG1-like 6..442 CDD:340843 32/152 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.