DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GYS1 and Alg11

DIOPT Version :9

Sequence 1:NP_002094.2 Gene:GYS1 / 2997 HGNCID:4706 Length:737 Species:Homo sapiens
Sequence 2:NP_001262182.1 Gene:Alg11 / 40402 FlyBaseID:FBgn0037108 Length:475 Species:Drosophila melanogaster


Alignment Length:537 Identity:113/537 - (21%)
Similarity:179/537 - (33%) Gaps:188/537 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    46 VLQTKAKV-TGDEWGDNYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIE 109
            :|..|.|: |..|.|.|..:..||...|...: .:|.....||:.          |....|.:|.
  Fly    29 LLGRKNKLHTSSENGINVGIFHPYCNAGGGGE-RVLWCAVRALQE----------KYQNARMVIY 82

Human   110 GGPLVVLLDVGASAWA-LERWKGELWDTCNIGVPWYDREANDAVLFGFLTT--WFLGEFLAQSEE 171
            .|      |:.||..: |::.|    :..||.|.      :|.|.|.||..  |.      :::.
  Fly    83 TG------DIDASPNSILQKAK----NVFNIAVD------SDNVKFVFLKQRHWI------EAKN 125

Human   172 KPHVVAHFHEWLAG-------VGL-CLCRARRLP----VATIFTTHATLLGRYLCAGAVDFYNNL 224
            .||..      |.|       ||| .||   |.|    :.|:.......|.|||....|..|.:.
  Fly   126 YPHFT------LLGQSIGSMVVGLEALC---RFPPDIYIDTMGYAFTYPLFRYLAQSKVGCYVHY 181

Human   225 ENFNVD--KEAGERQIYH---RY---------------------------CMERAAAHCA----H 253
            ...:.|  |...:||:.|   :|                           |.|....:.:    |
  Fly   182 PVISTDMLKRVQQRQMSHNNKKYVARNPFLTWTKLAYYRLFSRMYKWVGCCAETIMVNSSWTENH 246

Human   254 V-------FTT--------VSQITAIEAQHLLKRKPDIVTPNGLNVKKF----------SAMHEF 293
            :       |.|        ||.:.::  ||..|....|:    |:|.:|          .|::|.
  Fly   247 ILQLWDVPFKTHRVYPPCEVSHLKSL--QHTEKGDEFII----LSVGQFRPEKDHPLQLQAIYEL 305

Human   294 QNLHAQSKA---RIQEFVRGHFYGHLDF----NL-DKTLYFFIAGRYEFSNKGADVFLEALARLN 350
            :.|.||.:|   :|:..:.|......|:    |: |.|.:..:....:||   .:|..|.|.:| 
  Fly   306 RTLLAQDEALWNQIKLVIVGSCRNEDDYERLKNMQDLTKHLSLENNVQFS---VNVPYEDLLKL- 366

Human   351 YLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPD 415
                               .:|.:..:.|         :|:      |.||..:.||:..|.:..
  Fly   367 -------------------YQTAHIGIHT---------MWN------EHFGIGIVESMAAGLIMV 397

Human   416 MNK----MLD-KEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKV 475
            .:|    :|| .|.....:....||....:    ..|:|    :.|:......|:.|::...|:.
  Fly   398 AHKSGGPLLDIVETSAGSQNGFLATDAVEY----AENIL----NIIVNNSEMNGIRNAARASVER 454

Human   476 I----FHPEFLSSTSPL 488
            .    |...||.:.|.|
  Fly   455 FSEQEFEKNFLRAVSTL 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GYS1NP_002094.2 Glycogen_syn 31..663 CDD:283373 113/537 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 634..737
Alg11NP_001262182.1 PLN02949 24..473 CDD:215511 113/537 (21%)
GT1_ALG11_like 44..463 CDD:99978 103/512 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.