Sequence 1: | NP_002094.2 | Gene: | GYS1 / 2997 | HGNCID: | 4706 | Length: | 737 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_647772.1 | Gene: | Alg2 / 38374 | FlyBaseID: | FBgn0035401 | Length: | 424 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 37/196 - (18%) |
---|---|---|---|
Similarity: | 62/196 - (31%) | Gaps: | 48/196 - (24%) |
- Green bases have known domain annotations that are detailed below.
Human 399 KFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRI 463
Human 464 GLFNSSADRVKVIFHPEFLSSTSPLLPVDYEE--FVRGCHLGVFPSYYEPWGYTPAECTVMGIPS 526
Human 527 ISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTER 591
Human 592 L 592 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GYS1 | NP_002094.2 | Glycogen_syn | 31..663 | CDD:283373 | 37/196 (19%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 634..737 | ||||
Alg2 | NP_647772.1 | RfaB | 1..412 | CDD:223515 | 37/196 (19%) |
GT1_ALG2_like | 2..404 | CDD:99977 | 37/196 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0438 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |