DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GYS1 and Alg2

DIOPT Version :9

Sequence 1:NP_002094.2 Gene:GYS1 / 2997 HGNCID:4706 Length:737 Species:Homo sapiens
Sequence 2:NP_647772.1 Gene:Alg2 / 38374 FlyBaseID:FBgn0035401 Length:424 Species:Drosophila melanogaster


Alignment Length:196 Identity:37/196 - (18%)
Similarity:62/196 - (31%) Gaps:48/196 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   399 KFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRI 463
            ::.||...:|.:.||..:..||...||...:..|..    .:...|..|            :...
  Fly   230 RYERKKNHALALHSLRLLGDMLPATDFKRCRLIIAG----GYDTRCMEN------------VEHF 278

Human   464 GLFNSSADRVKVIFHPEFLSSTSPLLPVDYEE--FVRGCHLGVFPSYYEPWGYTPAECTVMGIPS 526
            .......:.:|:..|...|.|     |.|.|:  .:...|..::....|.:|..|.|......|.
  Fly   279 AELEHLTEELKLQDHVVLLRS-----PTDEEKCRLLFAAHCLLYTPENEHFGIVPLEGMYCSKPV 338

Human   527 ISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTER 591
            ::.|..|           |:              :...|..|.||....::|....::|..|.|:
  Fly   339 VALNSGG-----------PT--------------ETVVSTSTGFLCEKTEKSFGGAMLQLFRDEQ 378

Human   592 L 592
            |
  Fly   379 L 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GYS1NP_002094.2 Glycogen_syn 31..663 CDD:283373 37/196 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 634..737
Alg2NP_647772.1 RfaB 1..412 CDD:223515 37/196 (19%)
GT1_ALG2_like 2..404 CDD:99977 37/196 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.