DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GYS1 and PIG-A

DIOPT Version :9

Sequence 1:NP_002094.2 Gene:GYS1 / 2997 HGNCID:4706 Length:737 Species:Homo sapiens
Sequence 2:NP_001286547.1 Gene:PIG-A / 37020 FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster


Alignment Length:341 Identity:79/341 - (23%)
Similarity:121/341 - (35%) Gaps:110/341 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   196 LPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCME-----------RAAA 249
            |.:.|:||.| :|.|....:.|:.  |||...|:.      .:.|..|:.           |.|.
  Fly   113 LGLKTVFTDH-SLFGFADLSAALT--NNLLEVNLG------MVNHAICVSHIGKENTVLRARVAK 168

Human   250 HCAHV---------FTTVSQ-------ITAIEAQHLLKRKP-DIV---------TPNGLNV---- 284
            |...|         ||...|       |..:.|..|:.||. |::         ||| :|.    
  Fly   169 HRVSVIPNAVDTALFTPDPQQRPSNDIINIVVASRLVYRKGIDLLAGIIPRFKNTPN-INFIIVG 232

Human   285 ------------KKFSAMHEFQNLHAQSKARIQEF-VRGHFYGHLDFNLDKTLYFFIAGRYEFSN 336
                        :|.:.....|.:.|....|:::| ||||.:  |:.:|.:.....|.   |.::
  Fly   233 DGPKRDLLEEIREKTNMQERVQMVGAVEHNRVRDFLVRGHIF--LNTSLTEAYCMAIV---EAAS 292

Human   337 KGADV-------FLEALARLNYLLRVNGSEQTVVAFF--IMPA----RTNNFNVETLKGQAVRKQ 388
            .|..|       ..|.|.:...||    :|..:.|.:  |:.|    |.::|.|....|..   .
  Fly   293 CGLQVVSTSVGGIPEVLPKSLILL----AEPEIDAIYAAILIAIDRHRKSSFKVSPSVGNG---H 350

Human   389 LWDTAN-TVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPV-CTH--NML 449
            |...|| .||.:..||:...:....||.::             |..|.|..|..|| |.:  |.|
  Fly   351 LASDANGKVKRRRRRKVDTPISPTQLPAVS-------------APPADQNSSTEPVMCPYRCNEL 402

Human   450 DDS----SDPILTTIR 461
            .::    .|..|.|::
  Fly   403 VETLYNWEDVALRTVK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GYS1NP_002094.2 Glycogen_syn 31..663 CDD:283373 79/341 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 634..737
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 47/210 (22%)
GT1_PIG-A_like 2..451 CDD:99970 79/341 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.