DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRP12 and Cubn

DIOPT Version :9

Sequence 1:NP_038465.1 Gene:LRP12 / 29967 HGNCID:31708 Length:859 Species:Homo sapiens
Sequence 2:NP_727348.2 Gene:Cubn / 326235 FlyBaseID:FBgn0052702 Length:3750 Species:Drosophila melanogaster


Alignment Length:1070 Identity:196/1070 - (18%)
Similarity:327/1070 - (30%) Gaps:396/1070 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    22 LAGVYGNGA---LAEHSENVHISGVS------------------TACGETPEQIRAPSGIITSPG 65
            ||...||..   |..||..:.:..||                  ..||   ..|.|.||.:|||.
  Fly  1054 LAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGFDLTYTFEDRAKCG---GHIHASSGELTSPE 1115

Human    66 WPSEYPAKINCSWFIRANPGEIITISFQDFDIQGSRRCNLDWLTIETYKNIES---YRACGSTIP 127
            :|:.|.|.::|.|.:......::.|..::|:::.|..|:.|:|.:......:|   .|.||..||
  Fly  1116 YPANYSAGLDCDWHLTGTIDHLLEIQVENFELEQSPNCSADYLEVRNGGGTDSPLIGRFCGRDIP 1180

Human   128 PPYISSQDHIWIRFHSDDNISRKGFRLAY--FS-----------GKSEEP--------------- 164
            .........:.:..|:|..|:.:||||.:  |:           |....|               
  Fly  1181 ARIPGFSHEMRLILHTDSAINGRGFRLRWRIFAFGCGGSLRSNMGAISSPRYPNSYPNMAHCEWR 1245

Human   165 ----------------------NCACDQFRCGNGKCIPEAWKCNNMDECGDSSDEEICAKEANPP 207
                                  ||..|..:...|..:|....|..:  |.|........:..|..
  Fly  1246 ISLHPGSGISLLIEDLELEGLSNCYYDSVKIYTGIKLPNQSPCKVL--CKDDDLHNPLIQLENNK 1308

Human   208 TAAAFQPCAYNQFQ---------CLSRFTKV------------------YTC------------- 232
            ....|...|.|.|:         |:...|..                  ..|             
  Fly  1309 GTIVFDSDASNTFRGFRISYKANCIRNLTATTGTIESLNYMEPFWETIPINCSWTIRAPKGNRVL 1373

Human   233 ----------------------------------LPESLKCDGNI-----DCLDLGDEIDCDVPT 258
                                              .|:::...|.:     :..::..::|..:..
  Fly  1374 VEVSHLARHEQHVPTATMPGGLYIVDGRNVQEIVTPQAMNISGEVLTVVHNASNVNFQLDYRIDG 1438

Human   259 CGQWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILRFTDFKLDGTGYGDYVKIYDGLEE 323
            |.:.|:..:|.|.|||||..||....|.|||.......:.|...:..|:.:  .:..|  |.|..
  Fly  1439 CMEELRGTFGFFQSPNYPKMYPNNLECYWLITVEQDSAIELTINNIDLEDS--PNCTK--DALTV 1499

Human   324 NPHKLLRVLTAFDSHAPLT---VVSSSG-QIRVHFCADKVNAARGFNATYQVDGFCLPWEIPCGG 384
            :.||  ..:...:.|...|   |::||| ::.|.|.:|..:...||.|||:              
  Fly  1500 SNHK--NSVEVHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATYR-------------- 1548

Human   385 NWGCYTEQQRCDGYWHCPNGRDETNCTMCQKEEFPCSRNGVCYPRSDRCNYQNHCPNGSDEKNCF 449
                 |.:..|.|.....||       :.:...:|.:     ||...||.:|...          
  Fly  1549 -----TVKATCGGKLTARNG-------VIESPNYPLN-----YPAHSRCEWQVEV---------- 1586

Human   450 FCQPGNFHCKNNRCVFE--------SWVCD---------SQDD---------CGDGSDEE----- 483
                    .::::.|||        .:.|:         ::||         |||.::::     
  Fly  1587 --------SQHHQIVFEMADLNLESGYDCNWDYLEAYDLTEDDTEGERLFKVCGDETEDDKLLSS 1643

Human   484 --NCPVIVPTRVITAAVIGSL--------ICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEA 538
              |..|:   |.|:...:...        .||..:::         ...||:......|.:|.|:
  Fly  1644 SSNMAVV---RFISDDSVSKKGFRLHFHESCGQTIIV---------DETMFDYIQMSRQAARNES 1696

Human   539 ELLRREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSSNIW 603
            .|.                     .|....||:..:.....:.:|..   .:.:.|..|...|:.
  Fly  1697 CLW---------------------VFQAVEPNKRIIFTPTHVKLRED---ANQQYPTEGDCLNVG 1737

Human   604 NRIF-----------NFARSRHSGSLALVSADGDEV---VPSQSTSREPERNHTHRSLFSVESDD 654
            .:|:           .|.||...   ||:| :|..:   ||.|..  |..:.|    ..::::..
  Fly  1738 VKIYEGTEPQGTPRLKFCRSHPP---ALIS-NGQALTVSVPLQLV--EEFQGH----YMTMDTSC 1792

Human   655 TDTENERRDMAGASGGVAAP-LPQKVPPTT----AVEATVGACASSSTQSTRGGHADN-GRDVTS 713
            ....|      ..||...:| .|...||..    .:||::|...|.:.:|.....::: .||...
  Fly  1793 GSIYN------ALSGKFTSPYYPASYPPNIECLWLLEASMGNSLSLTLESMDLEKSESCNRDYLE 1851

Human   714 VEPPSVSP------ARHQLTSALSRMTQGLRWVRF-----TLGRSSSLSQNQSPLRQLDNGVSGR 767
            |...|.|.      ..:::...:.  ::|..|::|     .:|.....|.|.....:| ||..|.
  Fly  1852 VREESESGQLIGVYCGNEVPGVIH--SRGAIWMKFKSDDDNVGEGFMASYNYEHHNEL-NGTEGT 1913

Human   768 EDDD------------------DVEMLIPIS---------------DGSSD----FDVNDCSRPL 795
            .:..                  |.|.::.||               ||.||    .:|.|....:
  Fly  1914 IESPHFPSKFQDPVPYSWRITVDKEYVVAISLLYLRDLDQPHLNFYDGYSDIGARIEVTDPDETI 1978

Human   796 LDLASDQGQGLRQPYNATNPGVRPSNRDGP 825
            :              ::||.....||| ||
  Fly  1979 I--------------SSTNVVYFTSNR-GP 1993

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRP12NP_038465.1 CUB 47..158 CDD:238001 33/115 (29%)
LDLa 166..200 CDD:238060 7/33 (21%)
LDLa 215..254 CDD:238060 8/117 (7%)
CUB 267..371 CDD:238001 34/107 (32%)
LDLa 375..410 CDD:238060 5/34 (15%)
LDLa 413..448 CDD:238060 6/34 (18%)
LDLa 451..485 CDD:238060 9/66 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..678 11/58 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 693..723 7/36 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 748..770 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 801..823 4/21 (19%)
CubnNP_727348.2 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 282..322 CDD:214542
EGF_3 328..366 CDD:289699
EGF 430..457 CDD:278437
EGF_CA 469..503 CDD:238011
CUB 509..622 CDD:238001
CUB 627..737 CDD:238001
CUB 744..849 CDD:294042
CUB 853..970 CDD:238001
CUB 978..1094 CDD:238001 9/39 (23%)
CUB 1100..1211 CDD:238001 33/113 (29%)
CUB 1216..1330 CDD:238001 15/115 (13%)
CUB 1446..1549 CDD:238001 34/127 (27%)
CUB 1554..1667 CDD:238001 23/145 (16%)
CUB 1792..1899 CDD:238001 21/114 (18%)
CUB 1910..1998 CDD:294042 18/99 (18%)
CUB 2019..2133 CDD:238001
CUB 2140..2242 CDD:238001
CUB 2263..2379 CDD:238001
CUB 2385..2511 CDD:238001
CUB 2516..2630 CDD:238001
CUB <2833..2892 CDD:294042
CUB 2898..3008 CDD:238001
CUB 3011..3127 CDD:238001
CUB 3130..3241 CDD:238001
CUB 3254..3363 CDD:238001
CUB 3379..3508 CDD:238001
CUB 3531..3601 CDD:294042
CUB 3623..3733 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.