DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDIP1 and CG32280

DIOPT Version :9

Sequence 1:NP_001185983.1 Gene:CDIP1 / 29965 HGNCID:13234 Length:208 Species:Homo sapiens
Sequence 2:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster


Alignment Length:148 Identity:55/148 - (37%)
Similarity:71/148 - (47%) Gaps:20/148 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    61 MPQPGFIPPHMSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHT--ATVLVPSGAAT 123
            |.:||..||..    ||:||...||.......|..|.|||||...|....:|  .|.:||....:
  Fly     1 MSKPGSAPPQF----TYVPPPSAPPSYQEAVGGVKPVGPYTPVVAPATTANTTIVTTVVPISRTS 61

Human   124 TVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFK 188
            |              ..:||.|...|.|....|.|::.::.||.....||.||||||||.|:|..
  Fly    62 T--------------HMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCM 112

Human   189 DVTHTCPSCKAYIYTYKR 206
            ||.|:||:|:||:..|:|
  Fly   113 DVHHSCPNCRAYLGRYRR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDIP1NP_001185983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 5/9 (56%)
zf-LITAF-like 137..203 CDD:313756 29/65 (45%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 164..184 12/19 (63%)
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 30/82 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9092
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4979
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41224
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5213
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
99.060

Return to query results.
Submit another query.