DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rdh16 and Adhr

DIOPT Version :9

Sequence 1:NP_954678.1 Gene:Rdh16 / 299511 RGDID:735050 Length:317 Species:Rattus norvegicus
Sequence 2:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster


Alignment Length:161 Identity:45/161 - (27%)
Similarity:69/161 - (42%) Gaps:32/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Rat   109 LVNNAGISGHLGPNEWMNKQNIASVLDVNLLGMIEVTLSTVPLV-RK---ARGRVVNVASIAG-- 167
            |:|.|.:         .::.||.:.::.||.||:....:.:|.: ||   ..|.:|||.|:.|  
  Fly    89 LINGATL---------CDENNIDATINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVIGLD 144

  Rat   168 -RLSFCGGGYCISKYGVEAFSDSLRRELSYF--GVKVAIVEPGFFRTDVTN--------GVTLSS 221
             ...||  .|..||:||..|:.||...|.|.  ||.|..|..|..|..|..        |.:.:.
  Fly   145 PSPVFC--AYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVFVDRELKAFLEYGQSFAD 207

  Rat   222 NFQMLWDQTSSEVREVYGENYLASYLKMLNG 252
            ..:....|::|    |.|:|.:.:..:..||
  Fly   208 RLRRAPCQSTS----VCGQNIVNAIERSENG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rdh16NP_954678.1 type2_17beta_HSD-like_SDR_c 30..305 CDD:187665 45/161 (28%)
adh_short 30..214 CDD:278532 36/113 (32%)
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 45/161 (28%)
adh_short 7..195 CDD:278532 37/116 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.