DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cinp and CG34174

DIOPT Version :9

Sequence 1:NP_001100228.1 Gene:Cinp / 299334 RGDID:1563395 Length:212 Species:Rattus norvegicus
Sequence 2:NP_001097057.1 Gene:CG34174 / 5740699 FlyBaseID:FBgn0085203 Length:217 Species:Drosophila melanogaster


Alignment Length:194 Identity:45/194 - (23%)
Similarity:81/194 - (41%) Gaps:30/194 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat    13 KPVLSVSARKLKDNAADWHNLILKWDSLSDKGFTTASSIANLKVTLLSKEKVELESSSPTSIEEE 77
            |..|....::|:||.|       ||.....:|.:...:|...|...|.|             .::
  Fly    45 KTRLETIVKQLQDNYA-------KWQLAHQRGTSICYTIEAKKTKCLEK-------------SQD 89

  Rat    78 EKTNLDYDKGLEALCEELQAILDGLTKIQMKMEKLSSTTKGICELENYHYREESSRPPLFH-TWP 141
            |.::| |...|...|.:|..|......|....:::....:||.:|..      |:...:|: :|.
  Fly    90 EGSSL-YPDDLLLPCNKLAIIASIFGDIANNTKEILRQLRGILKLPG------SAADTIFYRSWK 147

  Rat   142 TAFFYEVSHQLSEAYRKELLLKHTIGAELAHTVDRNLSLTYLSMWLHQPYIESDSKLQLESMLL 205
            ...|...:.:|||.|.||.|:|..:...:||:.:|:..:.:.::|....::  ||.:.|..:||
  Fly   148 LQQFVVFAKELSERYEKEALVKMEVAGNIAHSTERSQLIAHTTLWEFPEHV--DSYVHLGFLLL 209



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353391
Domainoid 1 1.000 45 1.000 Domainoid score I11851
eggNOG 1 0.900 - - E1_2CXWD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5397
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408353at2759
OrthoFinder 1 1.000 - - FOG0009694
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.760

Return to query results.
Submit another query.