DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HCFC2 and slim

DIOPT Version :10

Sequence 1:NP_037452.1 Gene:HCFC2 / 29915 HGNCID:24972 Length:792 Species:Homo sapiens
Sequence 2:NP_523782.1 Gene:slim / 37121 FlyBaseID:FBgn0261477 Length:609 Species:Drosophila melanogaster


Alignment Length:391 Identity:85/391 - (21%)
Similarity:124/391 - (31%) Gaps:130/391 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    17 GPVPRARHGHRAVAIRELMIIFGGGNEGIA------------DELHVYNTATNQWFLP------- 62
            |..|.||.|||.:|....:...||.|...|            .||..||.||..|.|.       
  Fly   197 GGFPLARSGHRIIASNSHLYSLGGYNPRSAMSASRHGRCLLFQELWSYNFATRTWRLELNAGNAA 261

Human    63 -----------------------------------------------------AVRGDIPPGCAA 74
                                                                 .|:||:|.....
  Fly   262 NMPVELASNALTIHNNVLISHGGTGYPFGVSCSNDCYVYRTASAGATPGVDRLQVKGDLPTAQYG 326

Human    75 HGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPSGLPPCPRLGHSFSLYGNKC 139
            .|.|.....:...||...:. |:.::|.|.....:|:.|....|.....|..|..|.....|...
  Fly   327 PGIVIHKHFLYTIGGTTGFD-YTCDVYRLDLRTGIWENVYISRPEMRDDPEGRYRHEVVYDGKHI 390

Human   140 YLFGGLANESEDSNNNVPRY---LN--DFYEL-----ELQHGSGVVGWSIPVTKGVVPSPRESHT 194
            ::.||..:.|......:|.|   .|  |::|.     ......|..|:         |.||:..:
  Fly   391 FVLGGGTSHSVYDLQRIPAYNLEANCWDYFETYPDQRAADADDGNRGY---------PKPRKCFS 446

Human   195 AVIYCKKDSGSPKMYVFGGMCG---ARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNK 256
            .|.: :..:|..:.::.||:.|   ....|:|:|:|.|..|.:.|| ..:|.|...|:|:...|.
  Fly   447 CVQH-QSSTGDIEAFITGGLQGDFSTYFSDIWKLNLRTKHWYRIET-AILPRPLYFHSAAHSDNG 509

Human   257 -MYIFGG-----------------W--VPHKGENTETSPHDCEWRCTSSFSYL--NLDTTEWTTL 299
             ||:|||                 |  ||...|           .|..:.:|.  |||..:..||
  Fly   510 CMYVFGGIEYIDKEMRRRNDLYKMWMTVPKLSE-----------MCWDAITYYNDNLDLYDRKTL 563

Human   300 V 300
            :
  Fly   564 L 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HCFC2NP_037452.1 NanM 14..332 CDD:442289 85/391 (22%)
KELCH repeat 23..69 CDD:276965 20/117 (17%)
Kelch 1 34..79 17/116 (15%)
Kelch 2 83..130 10/46 (22%)
KELCH repeat 127..186 CDD:276965 13/68 (19%)
KELCH repeat 190..241 CDD:276965 14/53 (26%)
Kelch 3 207..255 15/50 (30%)
KELCH repeat 245..312 CDD:276965 19/78 (24%)
Kelch 4 257..303 16/65 (25%)
Kelch_5 312..355 CDD:433528
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..447
FN3 535..>704 CDD:442628
FN3 <618..672 CDD:238020
FN3 678..778 CDD:238020
slimNP_523782.1 NanM 197..516 CDD:442289 72/330 (22%)
KELCH repeat 203..263 CDD:276965 17/59 (29%)
KELCH repeat 267..321 CDD:276965 3/53 (6%)
KELCH repeat 324..364 CDD:276965 8/40 (20%)
KELCH repeat 442..495 CDD:276965 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.