DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HCFC2 and CG12081

DIOPT Version :10

Sequence 1:NP_037452.1 Gene:HCFC2 / 29915 HGNCID:24972 Length:792 Species:Homo sapiens
Sequence 2:NP_572494.1 Gene:CG12081 / 31799 FlyBaseID:FBgn0030053 Length:403 Species:Drosophila melanogaster


Alignment Length:82 Identity:17/82 - (20%)
Similarity:34/82 - (41%) Gaps:26/82 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    93 FGGGEARLMAE-------DDEEEQSFF-----SAPGTCVVDVGITNTQLIISHS----QKKWIH- 140
            |..|...|:::       |.|..:..|     |.|...:|.:..:|:|.:::.:    :.|:|| 
  Fly    32 FSKGYVDLLSQLTSVGNLDQEAFEKRFEAMRTSVPNYHIVVIEDSNSQKVVASASLVVEMKFIHG 96

Human   141 ---------LIMDTLQR 148
                     :::||..|
  Fly    97 AGSRGRVEDVVVDTEMR 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HCFC2NP_037452.1 NanM 14..332 CDD:442289 17/82 (21%)
KELCH repeat 23..69 CDD:276965
Kelch 1 34..79
Kelch 2 83..130 11/48 (23%)
KELCH repeat 127..186 CDD:276965 7/36 (19%)
KELCH repeat 190..241 CDD:276965
Kelch 3 207..255
KELCH repeat 245..312 CDD:276965
Kelch 4 257..303
Kelch_5 312..355 CDD:433528
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..447
FN3 535..>704 CDD:442628
FN3 <618..672 CDD:238020
FN3 678..778 CDD:238020
CG12081NP_572494.1 NanM 13..306 CDD:442289 17/82 (21%)
KELCH repeat 13..69 CDD:276965 8/36 (22%)
KELCH repeat 78..125 CDD:276965 7/36 (19%)
KELCH repeat 128..170 CDD:276965
KELCH repeat 180..236 CDD:276965
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.