DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2A and Ref1

DIOPT Version :10

Sequence 1:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens
Sequence 2:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster


Alignment Length:150 Identity:48/150 - (32%)
Similarity:73/150 - (48%) Gaps:23/150 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   105 RRRHTGSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFER 169
            :|...|..:.|   |.|.|..|....:..|::|:|:.:||:....|.|| |:|||.|.|.|.|||
  Fly    98 KRGAVGGGSGP---TRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYD-RSGRSLGTADVIFER 158

Human   170 IDDSKEAMERANGMELDGRRIRVDYSITKRA--HTPTPGIYMGR------PT-HSGGGGGGGG-- 223
            ..|:.:|:::.:|:.||||.:.:..:::..|  ..|.....:.|      || ...|||..||  
  Fly   159 RADALKAIKQYHGVPLDGRPMTIQLA
VSDVAVLTRPVAATDVKRRVGGTAPTSFKRGGGQAGGTA 223

Human   224 --------GGGGGGGGRRRD 235
                    ||....||:||:
  Fly   224 RRGFKRPVGGKPAAGGQRRE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 3/12 (25%)
RRM_TRA2 118..197 CDD:409798 29/78 (37%)
Linker 198..225 10/45 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245 15/51 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 32/89 (36%)
RRM_THOC4 109..183 CDD:410081 29/74 (39%)
FoP_duplication 202..>260 CDD:464005 14/41 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.