DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2A and Saf-B

DIOPT Version :9

Sequence 1:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens
Sequence 2:NP_733041.2 Gene:Saf-B / 42958 FlyBaseID:FBgn0039229 Length:928 Species:Drosophila melanogaster


Alignment Length:312 Identity:74/312 - (23%)
Similarity:118/312 - (37%) Gaps:70/312 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     3 DVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSHRR 67
            |.::.|.:|..|:             |.:.:||.:..|         |..:|..:|.:::....:
  Fly   226 DADKKNDDGARSK-------------KRDEKSGDKKDS---------SEQKSSGKSSNQKDDKEK 268

Human    68 YTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC---LGVFGLSLY 129
            .|.:...:.|....|.:.|        :|.|.|...|   .||:.:|....|.   |.|.|||..
  Fly   269 STAAPGGATSSTASSAAGS--------KSGSGSSAGN---GTGANSNNKQATLSRNLWVSGLSTL 322

Human   130 TTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDY 194
            |...||:.:||::|.:.|..||.:.||..:|.:.:|......|:...:|..:..||.||.|.|:.
  Fly   323 TRASDLKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASRCIENLHRTELHGRIISVER 387

Human   195 S--------ITKRAHTPTPGIY--------MGRPTHSGGGGGGG------GGGGGG-----GGGR 232
            :        .:|......||..        .|:.:.||.|....      ||.|.|     ||..
  Fly   388 TKNEIGG
SLNSKEGKGKAPGDAGNKKKEDDSGKKSGSGKGSSSNSGDDKKGGDGNGDSKSVGGDL 452

Human   233 RRDSYYDRGYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSY----SPR 280
            :||.   :..:|...|..|...:.......|.:.|.||...|:.:    :||
  Fly   453 KRDG---KESNRARSRRNDDRGKSLASQDRPRHDRERSAKGSQDHRSGRNPR 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 22/114 (19%)
RRM_TRA2 118..197 CDD:409798 27/89 (30%)
Linker 198..225 8/40 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245 14/62 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282 7/25 (28%)
Saf-BNP_733041.2 SAP 11..42 CDD:280251
RRM 205..>394 CDD:223796 49/200 (25%)
RRM_SAFB_like 313..386 CDD:240863 25/72 (35%)
SWIRM-assoc_1 <588..618 CDD:293104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1765
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.