DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2A and Rbp6

DIOPT Version :10

Sequence 1:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens
Sequence 2:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster


Alignment Length:99 Identity:35/99 - (35%)
Similarity:52/99 - (52%) Gaps:6/99 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   116 DPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA 180
            ||.. :.:.|||..|:...||:.|.|||.:|...|:.|..|.|||||.||.|...:...:.:.:.
  Fly    27 DPGK-MFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQG 90

Human   181 NGMELDGRRIRVDYSITKRAH----TPTPGIYMG 210
            . .||||:::....:..:|||    |.|..|::|
  Fly    91 T-HELDGKKVDPKVAFPRRAHPKMVTRTKKIFVG 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 1/1 (100%)
RRM_TRA2 118..197 CDD:409798 26/78 (33%)
Linker 198..225 7/17 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245 5/14 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 26/76 (34%)
RRM2_MSI 119..192 CDD:240769 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.