DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2A and cocoon

DIOPT Version :10

Sequence 1:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens
Sequence 2:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster


Alignment Length:149 Identity:45/149 - (30%)
Similarity:64/149 - (42%) Gaps:17/149 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    80 RRSRSRSYTPEYRRRRSRSH----SPMSNRRRHTGSRANPDPNT--------C--LGVFGLSLYT 130
            |.:..|.|:|.........|    .|..|:|:...:..|....|        |  |.|.|||..|
  Fly    54 RSNEGRLYSPSEETGWGEYHYFCVFPKKNKRQSEDNLENSTAKTKRTEAHLRCFDLIVLGLSYNT 118

Human   131 TERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYS 195
            ||:||||.|..||.:....:..|.|:|.|:||.||.|...|.....:.:.:  .:|||...|...
  Fly   119 TEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSKRH--SIDGRWCEVKVP 181

Human   196 ITKRAHTPTPG-IYMGRPT 213
            .::......|| :::||.|
  Fly   182 ASRGMGNQEPGKVFVGRCT 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 9/41 (22%)
RRM_TRA2 118..197 CDD:409798 31/88 (35%)
Linker 198..225 5/17 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245 5/14 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833 5/23 (22%)
RRM1_TDP43 108..181 CDD:409760 29/74 (39%)
RRM2_TDP43 193..262 CDD:409761 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.