DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2A and tsu

DIOPT Version :10

Sequence 1:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens
Sequence 2:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster


Alignment Length:122 Identity:38/122 - (31%)
Similarity:58/122 - (47%) Gaps:15/122 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    92 RRRRSRSHSPMSNRRR--HTGSRA-NPD-----PNTCLGVFGLSLYTT-------ERDLREVFSR 141
            :.|:.|.....||.|.  |:..|. |.|     |.....|.|..|:.|       |.:::|.|..
  Fly    31 KHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCD 95

Human   142 YGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITK 198
            ||.:..:::..|:|||.|:|:|.|.:|....:..|.|..||.|:.|:.|:||:...|
  Fly    96 YGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 9/33 (27%)
RRM_TRA2 118..197 CDD:409798 27/85 (32%)
Linker 198..225 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 14/48 (29%)
RRM_RBM8 67..154 CDD:409762 28/86 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.