DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2A and x16

DIOPT Version :10

Sequence 1:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens
Sequence 2:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster


Alignment Length:175 Identity:65/175 - (37%)
Similarity:82/175 - (46%) Gaps:32/175 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   111 SRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKE 175
            ||...|....:|..|.:  ..:.||..||..||.|..|.:..:     ..|||||.||...|:.:
  Fly     2 SRHPSDRKVYVGDLGNN--ARKNDLEYVFGAYGSLRSVWIARN-----PPGFAFVEFESARDAAD 59

Human   176 AMERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGG---------GGGG 231
            |:...:|..:.|||.||:.|             .|:...|||||||||||||         ||||
  Fly    60 AVRGLDGRTVCGRRARVELS-------------TGKYARSGGGGGGGGGGGGGGGLGGRDRGGGG 111

Human   232 RRRDSYYDRGYDRGYDRY-EDYDYRYRRRSPSPYYSRYRSRSRSR 275
            |..|..|:.|....:.|: .:...|.||||.|  :||.||.||.|
  Fly   112 RGDDKCYECGGRGHFARHCRERKARQRRRSNS--FSRSRSTSRRR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 3/6 (50%)
RRM_TRA2 118..197 CDD:409798 26/78 (33%)
Linker 198..225 10/26 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245 22/52 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282 9/16 (56%)
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 26/91 (29%)

Return to query results.
Submit another query.