DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2A and CG18259

DIOPT Version :10

Sequence 1:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens
Sequence 2:NP_573324.1 Gene:CG18259 / 32866 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster


Alignment Length:203 Identity:51/203 - (25%)
Similarity:87/203 - (42%) Gaps:39/203 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     4 VEENNFEGRE-SRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSHRR 67
            ::.|.|...| :|::.:.|:.|...|...|.:......|  :|.::.|.|:.....|||....:|
  Fly   243 IDNNAFSIYEAARNRIERPSLTNRLVVGRSNTTKEPLER--RHRDTASTSKLPESLRSRLFVGKR 305

Human    68 --YTRSRSHSHSHRRR---------------SRSRSYTPEYRRRRSRSHSPMSNRRRHT--GSRA 113
              :.....:::.:||:               |...:..|...:|  ||.||:|.|..:|  |.| 
  Fly   306 DPHISHGIYANENRRKAVGGGGARDSDSGTDSDGDAAAPSKNKR--RSPSPLSLRTSNTKDGYR- 367

Human   114 NPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAME 178
                   |.|..|....|..|:||:||..||      |||.|..|. |.|.|.::.::.:::|::
  Fly   368 -------LLVSNLHTNVTTADIRELFSDIGP------VYDARVVRP-GTAEVIYKSLEHAEKAVD 418

Human   179 RANGMELD 186
            ..:..:.|
  Fly   419 TYHHRQFD 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 30/133 (23%)
RRM_TRA2 118..197 CDD:409798 21/69 (30%)
Linker 198..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
CG18259NP_573324.1 RRM_SKAR 366..434 CDD:410082 22/76 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.