DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYLPF and sqh

DIOPT Version :9

Sequence 1:NP_001311387.1 Gene:MYLPF / 29895 HGNCID:29824 Length:169 Species:Homo sapiens
Sequence 2:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster


Alignment Length:166 Identity:86/166 - (51%)
Similarity:111/166 - (66%) Gaps:8/166 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     4 KRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELD 68
            |||:|.|     |:||:||||.||.||||||.:|||||||.::||||.|..|::|: |..::.||
  Fly    15 KRAQRAT-----SNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK-NPTDDYLD 73

Human    69 AMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQ 133
            .||.||.||||||:|||:|||:|:|.||||||..||...|.|..|.:.:..|.|||||..|||:.
  Fly    74 GMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTD 138

Human   134 EEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE 169
            |::..|:.. .|...|..||.....::.|| |||::
  Fly   139 EDVDEMYRE-APIKNGLFDYLEFTRILKHG-AKDKD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYLPFNP_001311387.1 FRQ1 15..154 CDD:227455 75/138 (54%)
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 84/162 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6417
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.