| Sequence 1: | NP_037418.3 | Gene: | RBM15B / 29890 | HGNCID: | 24303 | Length: | 890 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097394.1 | Gene: | CG4266 / 37411 | FlyBaseID: | FBgn0034598 | Length: | 1306 | Species: | Drosophila melanogaster |
| Alignment Length: | 403 | Identity: | 79/403 - (19%) |
|---|---|---|---|
| Similarity: | 114/403 - (28%) | Gaps: | 170/403 - (42%) |
- Green bases have known domain annotations that are detailed below.
|
Human 5 SERDSSPSGRGSSSSAKRPREREREAEAGGRRAAHKASGGAKHPVPARARDKPRGSGSGGGGHRD 69
Human 70 GRGTG----------DANHRASSGRSSG-----SGAGGGGRGG---------------KASGDPG 104
Human 105 ASGMS-------------------------PRASPLPP--------------------------- 117
Human 118 ---PPPPPGAEPACPGSSAAAPEYKTLLISSLSPALPAEHLEDRLFHQFKRFGEISLRLSHTPEL 179
Human 180 GRVAYVNFRHPQDAREARQHALARQLLLYDRPLKVEPVYLRGGGGSSRRSSSSSAAAST------ 238
Human 239 PPPGPP-----APADPLGYLPLHGGYQYKQRSLSPV---------------------AAPPLREP 277
Human 278 RARHAAAAFALDA 290 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RBM15B | NP_037418.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..133 | 42/212 (20%) | |
| RRM1_RBM15B | 137..218 | CDD:240998 | 12/80 (15%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 219..253 | 11/44 (25%) | |||
| RRM2_RBM15B | 329..413 | CDD:241000 | |||
| RRM3_RBM15B | 416..491 | CDD:241002 | |||
| RRM | 529..>639 | CDD:330708 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 547..705 | ||||
| Nuclear localization signal. /evidence=ECO:0000255 | 593..597 | ||||
| SPOC | 712..887 | CDD:311609 | |||
| Interaction with Epstein-Barr virus BMLF1 | 722..890 | ||||
| CG4266 | NP_001097394.1 | CID | 7..125 | CDD:239621 | |
| RRM | <488..>593 | CDD:223796 | |||
| RRM_SCAF4_SCAF8 | 490..566 | CDD:240673 | |||
| DUF2413 | 1147..>1254 | CDD:287302 | 24/133 (18%) | ||
| Herpes_DNAp_acc | <1206..1304 | CDD:282746 | 25/119 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR23189 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||