DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ulk2 and Aduk

DIOPT Version :9

Sequence 1:XP_006533571.1 Gene:Ulk2 / 29869 MGIID:1352758 Length:1051 Species:Mus musculus
Sequence 2:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster


Alignment Length:270 Identity:106/270 - (39%)
Similarity:168/270 - (62%) Gaps:10/270 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 VGDFEYCKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSK-SQILLGKEIKILKELQHEN 67
            :.|||..::  :|.|::|.|::.||:::..:. |||.:....||: |:..|..||::|:||:|:.
  Fly     6 ITDFEILEK--LGAGSYATVYKARHKKQRTYH-AIKYVEMSTLSQTSRENLITEIRLLRELKHKY 67

Mouse    68 IVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDL 132
            ||.|.|......::::|:||||.|:|:.:::.|..|.|.|.|.||.|:|||::.:.:..:.|.||
  Fly    68 IVTLQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDL 132

Mouse   133 KPQNILLSYANRRKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMYMAPEVIMSQHYDAKADL 197
            ||||:||:   |..:|||   :|:||||||::|....:...|.|||:|||||::....|||||||
  Fly   133 KPQNLLLT---RGANNVS---LKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADL 191

Mouse   198 WSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDF 262
            ||||.::|:||.||.|:.:.:.::|.:...|..::........|....:||..||......|:.|
  Fly   192 WSIGVILYECLFGKAPYSSRTIEELLLRIRKAEAITLPPNARISNECHDLLRRLLAHEPTARISF 256

Mouse   263 EAFFSHPFLE 272
            ..||:||||:
  Fly   257 ADFFAHPFLD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ulk2XP_006533571.1 STKc_ULK2 2..272 CDD:271103 105/268 (39%)
DUF3543 848..1019 CDD:371876
AdukNP_731331.1 S_TKc 9..265 CDD:214567 103/264 (39%)
PKc_like 13..264 CDD:304357 100/259 (39%)
MIT_2 274..348 CDD:239147
MIT 407..472 CDD:282117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1084750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5656
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.