DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cabp1 and Cam

DIOPT Version :9

Sequence 1:NP_001297641.1 Gene:Cabp1 / 29867 MGIID:1352750 Length:350 Species:Mus musculus
Sequence 2:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster


Alignment Length:148 Identity:62/148 - (41%)
Similarity:98/148 - (66%) Gaps:5/148 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse   202 LRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDF 266
            |..|:|.|.:|||..||||.||.|..::||..||::|..|||.||.::..:::.:..|.:||.:|
  Fly     5 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF 69

Mouse   267 VELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDV 331
            :.:|..|:    .|....:|:|:|||.||.:|:|.||.:|||..|.. ||.::...:::|:||:.
  Fly    70 LTMMARKM----KDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTN-LGEKLTDEEVDEMIREA 129

Mouse   332 DLNGDGRVDFEEFVRMMS 349
            |::|||:|::||||.||:
  Fly   130 DIDGDGQVNYEEFVTMMT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cabp1NP_001297641.1 PTZ00184 201..348 CDD:185504 60/145 (41%)
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 62/148 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.