DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf11 and CG6923

DIOPT Version :9

Sequence 1:NP_038904.1 Gene:Rnf11 / 29864 MGIID:1352759 Length:154 Species:Mus musculus
Sequence 2:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster


Alignment Length:168 Identity:35/168 - (20%)
Similarity:59/168 - (35%) Gaps:59/168 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse    36 PPPPYQEQVPVPIYHPTPSQTRLAT----QLTEEEQIRIAQRIGLIQHLPKG------------- 83
            |||..|:|.|........|....|:    ||..::|.:..|...::||:.:.             
  Fly  1065 PPPSPQQQSPATSGSGNSSVAAQASMRHLQLQPQQQPQAQQSPPVMQHMQRQRAIHHHMFHHHYS 1129

Mouse    84 -----------------VYDPGRDG-------------------------SEKKIRECVICMMDF 106
                             :..|.|..                         :::...:|.||:..|
  Fly  1130 PLHLEIGLAPLSLGSRILIAPSRPNRGATLETIERNTLPHKYRRVRRPSETDEDAEKCAICLNLF 1194

Mouse   107 VYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVD 144
            ...:.:|.|||||::|.||:|.||:.:..||.|...::
  Fly  1195 EIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIE 1232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf11NP_038904.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 6/15 (40%)
PPxY motif 37..40 2/2 (100%)
RING-H2_RNF11 98..140 CDD:319382 18/41 (44%)
RING-H2 finger (C3H2C3-type) 99..139 CDD:319382 18/39 (46%)
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 18/42 (43%)
zf-RING_2 1187..1228 CDD:290367 18/40 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.