DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mapk12 and rl

DIOPT Version :9

Sequence 1:XP_006521121.1 Gene:Mapk12 / 29857 MGIID:1353438 Length:390 Species:Mus musculus
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:364 Identity:150/364 - (41%)
Similarity:216/364 - (59%) Gaps:36/364 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse    21 WEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHEN 85
            :||...|..|..:|.||||.|.||.|:.|..:|||||: .||:.:.:.:|..||:.:|...:|||
  Fly    32 FEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQRTLREITILTRFKHEN 95

Mouse    86 VIGLLDVFTPDESLDDFTDFYLVMPFMGTDLGKLMKHETLSEDRIQFLVYQMLKGLKYIHAAGVI 150
            :|.:.|:...| |:|...|.|:|...|.|||.||:|.:.||.|.|.:.:||:|:||||||:|.|:
  Fly    96 IIDIRDILRVD-SIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVL 159

Mouse   151 HRDLKPGNLAVNEDCELKILDFGLARQADSE------MTGYVVTRWYRAPEVILNWMRYTQTVDI 209
            ||||||.||.:|:.|:|||.||||||.||.|      :|.||.||||||||::||...||:::||
  Fly   160 HRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDI 224

Mouse   210 WSVGCIMAEMITGKILFKGNDHLDQLKEIMKITGTPPPEFVQKLQSAEVSGSGWWAGLGLGGWPI 274
            ||||||:|||::.:.:|.|..:||||..|:.:.|:|..:.::                       
  Fly   225 WSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLE----------------------- 266

Mouse   275 TLFPSQAKNYMEGLPELEKKDFASVLTNASPQAVNLLERMLVLDAEQRVTAAEALTHPYFESLRD 339
            .:...:|:||:|.||......:|.:..||...|::||.:||..:..:|:...|||.|||.|...|
  Fly   267 CIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYD 331

Mouse   340 TEDEPKAQ---KYDDSFDDVDRTLEEWKRVTYKEVLSFK 375
            ..|||.|:   :.:...||:.|  :..|.:.::|.|.||
  Fly   332 PGDEPVAEVPFRINMENDDISR--DALKSLIFEETLKFK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mapk12XP_006521121.1 STKc_p38gamma 11..376 CDD:143385 150/364 (41%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 147/360 (41%)
S_TKc 38..326 CDD:214567 133/312 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.