DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GUCY1B1 and Gyc89Db

DIOPT Version :9

Sequence 1:XP_011530203.1 Gene:GUCY1B1 / 2983 HGNCID:4687 Length:662 Species:Homo sapiens
Sequence 2:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster


Alignment Length:727 Identity:203/727 - (27%)
Similarity:327/727 - (44%) Gaps:142/727 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDE--EGQFLVRIIYDDSKTYDLVAAASKVLNLNA 63
            |||.:..:::..:.:.||.|.|   :|..|:.:  ...|....||.|....|..||    |:.:.
  Fly     1 MYGMLYESVQHYIQQEYGMETW---RKVCQIVDCKHQSFKTHQIYPDKLMPDFAAA----LSAST 58

Human    64 GE----ILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTD 124
            ||    .:..||:.|..|....|||.::|..|....:|||::|.:|..:...||.|::||.:.|:
  Fly    59 GESFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQLTN 123

Human   125 AEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEE 189
            .: ..|.::.|.|.|.|:...:||.:..||::.:|.::...|::.:|:.|..|...|:..|....
  Fly   124 MD-DDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIKLTEGPLT 187

Human   190 DFYEDLDRFEENGTQESRISPY--------------TFCKAFPFHIIFDRDLVVTQCGNAIYRVL 240
            ...:....|:.......|::..              .|.:.|||.|:.|.|:.:|..|..|....
  Fly   188 VIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMKITLAGEKIVETW 252

Human   241 PQLQPG---------------NC-----------------SLLSVFSLVRP-H--------IDIS 264
            ....||               .|                 ::|..|.|:|. |        ::..
  Fly   253 ILHNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFELIRTGHNRAAYDAALNFD 317

Human   265 FHGI-----LSHINTVFVLRSKEGLLDVEKLEC------EDEL---TGTE-----ISCLRLKGQM 310
            |...     |:....:.:..:||...:..|.|.      :||:   ||..     :..:.|||||
  Fly   318 FENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEIDPATGQRRHSVGLRSILLKGQM 382

Human   311 IYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDR 375
            .|:.:.||::|||||.:.|||:|...||||:|:..|..:|:||:.|.|.      ..:|||:   
  Fly   383 FYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQH------CSKLEIM--- 438

Human   376 LQLTLRALEDEKKKTDTGCPARIQAFKVQTTLMLCEKDSRSTKGFPSISYSGFLLIPLNRLLYSV 440
                   .|.|::::|          :::.:|.|.  ||...:|              :.||||:
  Fly   439 -------FEKEEQRSD----------ELEKSLELA--DSWKRQG--------------DELLYSM 470

Human   441 LPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTD 505
            :|..:|..:|.......:.::.|:::|..::  |.:.|...:.:.||:.|..||.:   |..|.:
  Fly   471 IPRPIAERMRKSEEHVCQSFEEVSVIFIEVM--NIYDSGSNNIQDAMQAVTTLNKV---FSALDE 530

Human   506 SRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGE 570
            ...:||||||||||..||.|||.|:....||...|.|||.:|:......:.|  |.|.:||::|.
  Fly   531 EIISPFVYKVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKVKAHALPG--VAIRVGINSGP 593

Human   571 VVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSM 635
            ||.||:|.::|||||||:|||..||.|::.:...|.:|.||     :.:.....:.:|.||.|.:
  Fly   594 VVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYT-----ALKVQKVGYKVEARGFVKV 653

Human   636 KGKKEPMQVWFL 647
            |||.|....|.|
  Fly   654 KGKGEMETYWLL 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GUCY1B1XP_011530203.1 HNOB 2..166 CDD:311572 48/169 (28%)
HNOBA 207..449 CDD:311573 74/315 (23%)
Guanylate_cyc 455..648 CDD:306677 72/193 (37%)
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167 48/166 (29%)
HNOBA 218..479 CDD:400168 73/302 (24%)
Nucleotidyl_cyc_III 488..665 CDD:416391 71/188 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245586at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.