DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GUCY1A1 and ACXB

DIOPT Version :9

Sequence 1:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens
Sequence 2:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster


Alignment Length:307 Identity:75/307 - (24%)
Similarity:132/307 - (42%) Gaps:67/307 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   368 GQMIYIVE------SSAILFLGSPCVDRLE--DFTGRGLY---LSDIPIHNALRDVVLIGEQARA 421
            |..||.::      |..:..|.:.|||...  .|...|::   ::|..:.::..|          
  Fly   181 GLFIYFLKSDDEDISEVVHDLDTICVDIFHYLGFNLMGIFFRIMNDTMVRSSFLD---------- 235

Human   422 QDGLKKRLGKLKATLEQAHQALEEE------KKKTVDLLCSIFPCEVAQQLWQG----------- 469
                             .||.|:||      :::...||.||.|.::|:.:.|.           
  Fly   236 -----------------RHQFLKEEMWLRQARQQESMLLDSILPPQIAKPIQQSIKERIMLSETD 283

Human   470 ---QVVQAKKFSN---------VTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDV 522
               .||.|::..|         |::|::|:|.:|.:.:..:..:::.:|:.||.|||.......|
  Fly   284 SDRIVVNARRTENFMAIQIHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAASTFKV 348

Human   523 YKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVV 587
            .:::.:||.|....||.:....||.....:.:.|:....||.:.....|.||||:|||::.|||:
  Fly   349 QRIKFLGDCYYCVAGLGEADPDHARMAVSLGISMIANIQEVRAHRALDIDMRIGVHSGTLLAGVI 413

Human   588 GVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVF 634
            |....:|.::|.:|.:||:.|:...|..::||..|...|......||
  Fly   414 GQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSLNVAEYTVF 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 23/114 (20%)
Guanylate_cyc 472..643 CDD:306677 50/172 (29%)
ACXBNP_620474.2 AC_N <36..276 CDD:292831 24/121 (20%)
CYCc 249..459 CDD:214485 56/209 (27%)
Nucleotidyl_cyc_III 298..484 CDD:299850 47/163 (29%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.