DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GUCY1A1 and ACXE

DIOPT Version :9

Sequence 1:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens
Sequence 2:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster


Alignment Length:278 Identity:77/278 - (27%)
Similarity:136/278 - (48%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   370 MIYIVE-----SSAILFLGSPCVDRLEDFTGRGLYLSDIPI-HNALRDVVLIGEQARAQDGLKKR 428
            :|:|.:     :||:..:|...||.:     ..|.|:.:.| :..:.|.|:..........:|::
  Fly   180 VIFIAQGFAQFASALFSVGGMSVDIV-----HYLCLNLVGIFYRVMNDTVVRSSFLDRHQYIKEK 239

Human   429 LGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVA---QQLWQGQVVQAKK-------------- 476
            :....|.|        :||:    ||.||.|.:::   |:..||::|.||:              
  Fly   240 IWLRNARL--------QEKQ----LLDSILPPQISLPLQKDIQGR
IVMAKQGIHSWTAMERTMAI 292

Human   477 --FSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLH 539
              ..:|::|::|:|.:|.:.:..:...::.:|:.||.|||.......|.:::.:||.|....||.
  Fly   293 QIHPDVSILYADVVNYTHLTTTLTVEMLVKVLHDLYGRFDLAAYRYKVQRIKFLGDCYYCVAGLS 357

Human   540 KESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLA 604
            .....||....::.|.|:....||...||..|.||||:|||::||||:|....::.::|.:||:|
  Fly   358 DPDPDHANNCVILGLSMINHIMEVRDIHGLDINMRIGVHSGNLFAGVIGEAKLQFDIWGLDVTIA 422

Human   605 NKFESCSVPRKINVSPTT 622
            |..||..||..:::|..|
  Fly   423 NVLESTGVPGCVHISGAT 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 23/104 (22%)
Guanylate_cyc 472..643 CDD:306677 52/167 (31%)
ACXENP_652601.3 AC_N <31..272 CDD:318454 24/108 (22%)
Nucleotidyl_cyc_III 290..459 CDD:325147 49/151 (32%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.