DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GUCY1A1 and Gyc89Db

DIOPT Version :9

Sequence 1:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens
Sequence 2:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster


Alignment Length:588 Identity:145/588 - (24%)
Similarity:245/588 - (41%) Gaps:146/588 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   161 DFLNSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHV 225
            |||.|...:     |.|......:::..|:...:.:||...:.|...:...|..|.|.:...|..
  Fly    95 DFLQSIDNI-----HVQMRFTYPKMKSPSMQLTNMDDDGAVILYRSGRTGMSKYLIGQMTEVAKE 154

Human   226 LYETEVEVSLMPPCFHND-CS---------------------EFVNQPYLLYSVHMKSTKPSLS- 267
            .|..::...::..  .|| |.                     :|.|:.|:...|::.:....|. 
  Fly   155 FYGLDMTAYVLES--QNDICGGTAGPIKLTEGPLTVIVKYRLDFDNRDYMAKRVNVIAHPSQLKM 217

Human   268 PSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIRRL-------MNRRDFQGKPNFEEYFE 325
            ||       :..::|.:.|||..:.|.||.|...|..|...       :|.:.|.|. :..|.|:
  Fly   218 PS-------VDLNVFLELFPFTIVLDHDMKITLAGEKIVETWILHNPGVNPKTFIGS-HILERFK 274

Human   326 ILTPKINQ-TFSGIMTMLNMQFVVRVRR---------------WDNSVKKSS------------- 361
            ...||..| .:..|:.|..:.|...:.|               ::|..:.||             
  Fly   275 CRRPKDTQIQWETILQMRTVLFEFELIRTGHNRAAYDAALNFDFENFDEASSLNEAQAMALASAK 339

Human   362 ----------------------------------RVMDLKGQMIYIVESSAILFLGSPCVDRLED 392
                                              |.:.|||||.||.:..:::||.||.::.|::
  Fly   340 EFSAENAKEEAAAAATSKDEIDPATGQRRHSVGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDE 404

Human   393 FTGRGLYLSDIPIHNALRDVVLIGEQARAQ-----DGLKKRLGKLKATLEQAHQALEEEKKKTVD 452
            ..|.||||:|:..|...|::|:.|.|..::     :..::|..:|:.:||.|    :..|::..:
  Fly   405 LHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELA----DSWKRQGDE 465

Human   453 LLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQ--CSPLQVITMLNALYTRFDQ 515
            ||.|:.|..:|:::.:.:....:.|..|:::|.:::......|.  ...:|.:|.||.:::..|:
  Fly   466 LLYSMIPRPIAERMRKSEEHVCQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDE 530

Human   516 QCGELDVYKVETIGDAYCVAGG------LHKESDTHAVQIALMALKMMELSDEVMSPHGEP-IKM 573
            :.....||||||:|..|....|      ||.|   ||..:||..:|.::       .|..| :.:
  Fly   531 EIISPFVYKVETVGMVYMAVSGAPDVNPLHAE---HACDLALRVMKKVK-------AHALPGVAI 585

Human   574 RIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLK--------DCP 630
            |:|::||.|.|||||:|:|||||||:.|..|::.||.|.|..|.:|  .|..||        :..
  Fly   586 RVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLS--NYTALKVQKVGYKVEAR 648

Human   631 GFV 633
            |||
  Fly   649 GFV 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 60/263 (23%)
Guanylate_cyc 472..643 CDD:306677 60/179 (34%)
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167 15/70 (21%)
HNOBA 218..479 CDD:400168 62/272 (23%)
Nucleotidyl_cyc_III 488..665 CDD:416391 60/176 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245586at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.