DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GUCY1A1 and Gyc89Da

DIOPT Version :9

Sequence 1:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens
Sequence 2:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster


Alignment Length:570 Identity:143/570 - (25%)
Similarity:243/570 - (42%) Gaps:141/570 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   161 DFLNSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHV 225
            |||.|...:     |........:::..|:...:.:|:...:.|...:...|..|.|.:...|..
  Fly    95 DFLQSIDNI-----HLIMRFTYPKMKSPSMQLTNMDDNGAVILYRSSRTGMSKYLIGQMTEVARE 154

Human   226 LYETEVEVSLMPPCFHNDCS----------------------EFVNQPYLLYSVHMKSTKPSLSP 268
            .|..|::..::..  .||.|                      :|.|:.|:...|:.::     .|
  Fly   155 FYGLEIKAYVIES--QNDISGGTAGPIKLTDGPLTVIVKYRLDFDNREYMAKRVNTEA-----HP 212

Human   269 SKPQSSLVIPT---SLFCKTFPFHFMFDKDMTILQFGNGIRRL-------MNRRDFQGKPNFEEY 323
            |:    |.:||   .:|...|||.|:.:.||.|...|..|...       .|.:.|.| .:..:.
  Fly   213 SQ----LKMPTVKLDVFLDLFPFTFVLNHDMKITHAGEKIVETWIMHNPGANPKSFIG-THVMDL 272

Human   324 FEILTPK--------------INQTFSGIMT---------MLNMQF---------------VVRV 350
            |:...||              :...|..|.|         :|||.|               :.:.
  Fly   273 FQCRRPKDTTIDWDTLIQMRAVLFEFELIRTGHNRAAYDAVLNMDFENYDEMDLNEAQTMALAKA 337

Human   351 RRWDNS-------------------VKKSS---RVMDLKGQMIYIVESSAILFLGSPCVDRLEDF 393
            :.:..|                   .::||   |.:.|||||.||.:..:::||.||.::.|::.
  Fly   338 QEFSESHPVDDDESAREDEIDPATGERRSSQGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDEL 402

Human   394 TGRGLYLSDIPIHNALRDVVLIGEQARAQ-----DGLKKRLGKLKATLEQAHQALEEEKKKTVDL 453
            .|.||||:|:..|...|::|:.|.|..::     :..::|..:|:.:||.|    :..|::..:|
  Fly   403 HGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELA----DSWKRQGDEL 463

Human   454 LCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIV-----GFTAICSQCSPLQVITMLNALYTRF 513
            |.|:.|..:|:::...:....:.|..|:::|.:::     |..:|   ...:|.:..||.:::..
  Fly   464 LYSMIPRPIAERMRLSEEQVCQSFEEVSVIFLEVMNVYDEGLNSI---QGAMQTVNTLNKVFSAL 525

Human   514 DQQCGELDVYKVETIGDAYCVAGG------LHKESDTHAVQIALMALKMMELSDEVMSPHGEPIK 572
            |::.....||||||:|..|....|      ||.|   ||..:||..:|..:..|     .|: :.
  Fly   526 DEEIISPFVYKVETVGMVYMAVSGAPDVNPLHAE---HACDLALRVMKKFKAHD-----MGD-VA 581

Human   573 MRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTT 622
            :|:|::||.|.|||||.|:|||||||:.|..|::.||.|.|.||.:|..|
  Fly   582 IRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYT 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 63/263 (24%)
Guanylate_cyc 472..643 CDD:306677 56/162 (35%)
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002 14/70 (20%)
HNOBA 218..476 CDD:285003 63/262 (24%)
CYCc 457..643 CDD:214485 62/187 (33%)
Guanylate_cyc 485..662 CDD:278633 56/159 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245586at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.