DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GUCY1A1 and CG14877

DIOPT Version :9

Sequence 1:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:237 Identity:51/237 - (21%)
Similarity:81/237 - (34%) Gaps:75/237 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    38 ESCKATVPICQDIPEKNIQESLPQRKTSRSRVYLHTLAESICK-----------LIFPEFERLNV 91
            :.|.||   |::.|.::                    .|:||.           ::.|:......
  Fly    15 KDCVAT---CREEPARD--------------------CEAICDANGRNCTIRALVLLPDDNMYQA 56

Human    92 ALQRTLAKHKIKESR---KSL--EREDFEKTIAEQAVAAGVPVEVIKESLGEEVFKICYEEDENI 151
            :|.|.|...|:.|.:   |||  ...|||....:....|.  :.|||...|  :.|.|.:     
  Fly    57 SLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDAS--LGVIKAMDG--IIKQCAQ----- 112

Human   152 LGVVGGTLKDF-LNSFSTLLK----QSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRTT 211
              |:.|.:.|: |.:.|.:.|    |.:.....|  |...|......|..|:|     :...||.
  Fly   113 --VIFGPVCDYSLAAVSRITKYFNSQGTPLISVG--GSTYDFEQKKTDCNDEF-----YMLLRTG 168

Human   212 SLILPGIIKAAAHVL-----------YETEVEVSL--MPPCF 240
            .|....|.:...:|:           ||.:.:.|:  |..||
  Fly   169 MLSFETISELTINVMKRHNWSHSIFYYERDGQRSVAGMHTCF 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168
Guanylate_cyc 472..643 CDD:306677
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 43/183 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.