DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GUCY1A1 and Ac78C

DIOPT Version :9

Sequence 1:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens
Sequence 2:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster


Alignment Length:224 Identity:71/224 - (31%)
Similarity:117/224 - (52%) Gaps:33/224 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   438 QAHQALEEEK------KKTVDLLCSIFP----CEVAQQLWQG--QVVQAK-------KFSNVTML 483
            :.|:|:|.:|      ::|..||.||.|    .::..::::|  ..|:.:       ...||::|
  Fly   513 ETHKAMEHKKESEKELQRTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYPMDNVSIL 577

Human   484 FSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDA-YCVAGGLHKESDT--- 544
            |:||.|||.:.|:.|..|::.:||.|:.|||:...:....:|:.:||. |||:   ..|||.   
  Fly   578 FADIKGFTELASKTSAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVS---QFESDNWKT 639

Human   545 ---HAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANK 606
               |||......|.|::...:|.......:.||||:|||||..||:|.|...:.::.|:|.:||.
  Fly   640 RPDHAVCSVETGLHMIKAIKDVRLHTHVDLNMRIGIHSGSVMCGVLGNKKWHFDVWSNDVIIANH 704

Human   607 FESCSVPRKINVSPTTYRLLKDC----PG 631
            .||..:|.::::|..|.:.|.|.    ||
  Fly   705 MESGGIPGRVHISEATLKCLNDAYEVEPG 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 10/37 (27%)
Guanylate_cyc 472..643 CDD:306677 60/178 (34%)
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 10/37 (27%)
CYCc 526..729 CDD:214485 65/205 (32%)
Guanylate_cyc 566..753 CDD:278633 59/171 (35%)
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485
Guanylate_cyc 1381..1576 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.