DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GUCY1A1 and CG3216

DIOPT Version :9

Sequence 1:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens
Sequence 2:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster


Alignment Length:250 Identity:109/250 - (43%)
Similarity:147/250 - (58%) Gaps:12/250 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   404 PIHNALRD---VVLIGEQARAQDGLKKRL----GKLKATLEQAHQALEEEKKKTVDLLCSIFPCE 461
            |..:.:|.   .::.|......|.|..|:    ..|::.:|:..:.|..||::|.:||..|.|..
  Fly   870 PTFSTIRSNIRTIMKGFCENLMDDLLNRMEQYANNLESLVEEKTRQLSLEKQRTEELLYQILPRP 934

Human   462 VAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVE 526
            |||||..|.:|:.::||:||:.||||||||.:|::.||:.|:..||.||:.||:..|..||||||
  Fly   935 VAQQLMAGDLVEPEEFSSVTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVE 999

Human   527 TIGDAYCVAGGL-HKESDTHAVQIALMALKMMELSDEVMSPHGEP---IKMRIGLHSGSVFAGVV 587
            ||||||.|..|| ....|.||.:||||||.::.........| :|   |::|||:|||||.||||
  Fly  1000 TIGDAYLVVSGLPEPNGDKHAREIALMALDILRAVSSFNLRH-KPEYKIQIRIGMHSGSVCAGVV 1063

Human   588 GVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREEL 642
            |.|||.|||||:.|..|::.||...|.||:||..|..:|.....|....|...||
  Fly  1064 GKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVEL 1118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 19/68 (28%)
Guanylate_cyc 472..643 CDD:306677 86/174 (49%)
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357 2/14 (14%)
TyrKc 627..877 CDD:197581 1/6 (17%)
HNOBA <882..939 CDD:285003 17/56 (30%)
CYCc 918..1109 CDD:214485 96/191 (50%)
Guanylate_cyc 945..1131 CDD:278633 86/174 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.