DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GUCY1A1 and rut

DIOPT Version :9

Sequence 1:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens
Sequence 2:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster


Alignment Length:232 Identity:73/232 - (31%)
Similarity:121/232 - (52%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   412 VVLIG------------EQARAQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQ 464
            |:.||            |:|:.:..|..| ..:.:.||     :::|.:|...||.|:.|..||.
  Fly   191 VIFIGVNVAGLVVNIMMERAQRRTFLDTR-NCIASRLE-----IQDENEKLERLLLSVLPQHVAM 249

Human   465 QLWQ-------GQV--VQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGEL 520
            |:..       ||.  :..:|..||::||:||||||.:.||||..:::.:||.|:.||||...:.
  Fly   250 QMKNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQCSAQELVRLLNELFGRFDQLAHDN 314

Human   521 DVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAG 585
            ...:::.:||.|....||.:....||.....|.|.|::....|:......:.||:|:|:|.|..|
  Fly   315 HCLRIKILGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCG 379

Human   586 VVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTT 622
            |:|::..::.::.|:|||||..||...|.:::|:..|
  Fly   380 VLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRAT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 17/65 (26%)
Guanylate_cyc 472..643 CDD:306677 53/151 (35%)
rutNP_511156.2 AC_N <17..255 CDD:292831 18/69 (26%)
CYCc 230..425 CDD:214485 64/187 (34%)
Guanylate_cyc 266..438 CDD:278633 53/151 (35%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.