DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GUCY1A1 and CG32305

DIOPT Version :9

Sequence 1:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens
Sequence 2:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster


Alignment Length:244 Identity:70/244 - (28%)
Similarity:118/244 - (48%) Gaps:34/244 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   448 KKTVDLLCSIFPCEVAQQLWQGQVV-----QAKKFS---------------NVTMLFSDIVGFTA 492
            ||...||.||.|.::.:.| |.::.     |.|.|:               ||::|.:|:|.:|.
  Fly   246 KKENGLLESILPRKMIRTL-QEEICSRIEDQDKNFTPSKAGLRKLFLEPYPNVSILVADMVNYTH 309

Human   493 ICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAY-CVAGGLHKESDTHAVQIALMALKM 556
            :.:.....|::.:|:.|:..||.........:::.:||:| ||| |:......||......||:|
  Fly   310 LTTTLEAPQLVEILHDLFVNFDLAANRNRAMRIKFLGDSYNCVA-GIPNYFPAHASCCVDQALEM 373

Human   557 MELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPT 621
            :.::..|.|.....|.:|||:|||.||||::|....::.::..:|.:.|:.||..:|..::||..
  Fly   374 IHITQGVSSRRELDINLRIGVHSGEVFAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVSQR 438

Human   622 TYRLLKDCPGFVFTPRSREELPPNFP-SEIPGICHFL------DAYQQG 663
            |..:|.:  .::|  |...|...|.| .:..||..||      ||.:.|
  Fly   439 TLSMLDE--HYIF--REGTEAAKNDPILQQAGIRTFLVSNRLPDAVEPG 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 7/17 (41%)
Guanylate_cyc 472..643 CDD:306677 52/191 (27%)
CG32305NP_728725.2 CYCc 251..449 CDD:214485 56/201 (28%)
Nucleotidyl_cyc_III 292..445 CDD:299850 46/153 (30%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.